KEGG   Rhodococcus jostii: RHA1_ro04683Help
Entry
RHA1_ro04683      CDS       T00382                                 

Definition
(GenBank) probable nonspecific lipid carrier protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rha  Rhodococcus jostii
Pathway
rha00071  Fatty acid degradation
rha00072  Synthesis and degradation of ketone bodies
rha00280  Valine, leucine and isoleucine degradation
rha00310  Lysine degradation
rha00362  Benzoate degradation
rha00380  Tryptophan metabolism
rha00620  Pyruvate metabolism
rha00630  Glyoxylate and dicarboxylate metabolism
rha00640  Propanoate metabolism
rha00650  Butanoate metabolism
rha00900  Terpenoid backbone biosynthesis
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01212  Fatty acid metabolism
rha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro04683
   00630 Glyoxylate and dicarboxylate metabolism
    RHA1_ro04683
   00640 Propanoate metabolism
    RHA1_ro04683
   00650 Butanoate metabolism
    RHA1_ro04683
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro04683
   00072 Synthesis and degradation of ketone bodies
    RHA1_ro04683
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro04683
   00310 Lysine degradation
    RHA1_ro04683
   00380 Tryptophan metabolism
    RHA1_ro04683
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHA1_ro04683
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHA1_ro04683
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RHA1_ro04683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rha04147]
    RHA1_ro04683
Enzymes [BR:rha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RHA1_ro04683
Exosome [BR:rha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHA1_ro04683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Peptidase_M22 SpoVAD
Motif
Other DBs
NCBI-ProteinID: ABG96469
UniProt: Q0S7L7
Position
complement(4934813..4935988)
Genome map
AA seq 391 aa AA seqDB search
MANQLAAVLGTGQTHYVAKRHDVSMAGLVREAIDRAMEDARVGWDDIDAVVIGKAPDLFE
GSMMPELAMSDALGANGKPLLRVHTAGSVGGSTAVVASSLVKSGVHKRVLTVAWEKQSES
NAMWALSTPIPFHMPVGAGAGGYFAPHVRSYIRRSGAPDHIGAMVAVKDRLNGSLNPYAH
LKQPDITLESVQASQMLWDPIRYDETCPSSDGACAMVIGNEEAAEQVTADGREVAWIHAT
AMRTEPTTFAGRDQVNPQAGRDAAAALWKAAGIKDPLDEIDVAEIYVPFSWFEPMWLENL
GFVSEGEGWKLTEAGETAIGGRLPLNASGGVLSSNPIGASGMIRFAESAMQVMHRAGDHQ
VKDARKALGHAYGGGSQYFSMWVVGSDRPNN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcaattggccgcggtgctcggcaccggtcagacgcattacgtggcgaagcgg
cacgacgtgtccatggcggggctggttcgcgaggcgatcgaccgcgcgatggaagacgcc
cgggtgggctgggacgacatcgacgccgtcgtgatcgggaaggcccccgacctcttcgag
ggttcgatgatgccggagctcgcgatgtcggacgcgctgggcgccaacggcaaaccgctc
ctgcgcgtgcacaccgcaggctcggtcgggggctcgaccgcggtggtcgcgtcgagtctc
gtgaagtcgggggtgcacaagcgggtgctgacggtggcgtgggagaagcagtccgagtcg
aatgccatgtgggcgctgtccacccccattccattccacatgccggtcggcgcgggcgcg
ggcggctacttcgccccgcacgtccgctcgtacatccggcggtcgggcgcacccgatcac
atcggcgcgatggtggcggtgaaggaccggctgaacggcagcctcaatccgtacgcccac
ctcaagcaacccgacatcacgctcgaatccgtgcaggcctcgcagatgctgtgggatccc
atccgctacgacgagacgtgtccgtcctcggacggcgcctgcgcgatggtgatcggcaac
gaggaggcagccgagcaggtcacggcggacggtcgtgaggtggcctggatccacgccacc
gcgatgcgcaccgagcccaccacgttcgcgggacgcgaccaggtgaatccgcaggccggc
cgggacgcggcggccgcgctgtggaaggccgcgggcatcaaggacccgctcgacgagatc
gacgtggccgaaatctacgtccccttctcctggttcgaaccgatgtggctcgagaatctg
ggcttcgtctccgagggtgagggctggaaactcaccgaggcgggcgagaccgcgatcggc
ggccggcttccgctcaacgcgtccggcggcgtcctgtcgtccaaccccatcggcgcctcg
ggcatgatccggttcgccgagtcggcgatgcaggtgatgcaccgcgccggcgaccatcag
gtgaaggacgcacgcaaggcactcggccacgcctatggcggcggttcgcagtacttctcg
atgtgggtggtcggttccgaccggccgaacaattag

DBGET integrated database retrieval system