KEGG   Rhodococcus jostii: RHA1_ro04688Help
Entry
RHA1_ro04688      CDS       T00382                                 

Gene name
echA19
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rha  Rhodococcus jostii
Pathway
rha00071  Fatty acid degradation
rha00280  Valine, leucine and isoleucine degradation
rha00281  Geraniol degradation
rha00310  Lysine degradation
rha00360  Phenylalanine metabolism
rha00362  Benzoate degradation
rha00380  Tryptophan metabolism
rha00410  beta-Alanine metabolism
rha00627  Aminobenzoate degradation
rha00640  Propanoate metabolism
rha00650  Butanoate metabolism
rha00903  Limonene and pinene degradation
rha00930  Caprolactam degradation
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01212  Fatty acid metabolism
Module
rha_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RHA1_ro04688 (echA19)
   00650 Butanoate metabolism
    RHA1_ro04688 (echA19)
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro04688 (echA19)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro04688 (echA19)
   00310 Lysine degradation
    RHA1_ro04688 (echA19)
   00360 Phenylalanine metabolism
    RHA1_ro04688 (echA19)
   00380 Tryptophan metabolism
    RHA1_ro04688 (echA19)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RHA1_ro04688 (echA19)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHA1_ro04688 (echA19)
   00281 Geraniol degradation
    RHA1_ro04688 (echA19)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHA1_ro04688 (echA19)
   00627 Aminobenzoate degradation
    RHA1_ro04688 (echA19)
   00930 Caprolactam degradation
    RHA1_ro04688 (echA19)
Enzymes [BR:rha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RHA1_ro04688 (echA19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABG96474
UniProt: Q0S7L2
Position
complement(4940352..4941176)
Genome map
AA seq 274 aa AA seqDB search
MSSTTTEKSDISAQSPHCLVEKRGHVLIVTMNRPEAKNALSGEMMAIMRDAWDQVDSDPD
IRVAILTGAGGAFCAGADLKAMTSQHPGDSFSGGGWDLSKIEALLKGRRLTKPLIAAVEG
PAIAGGTEILQGTDIRIAGESAKFGVSEAKWGLFPLGGSAVRLVRQIPYTVAADILLTGR
HIKAPEAKEIGLIGHVVPDGQALDKALELADLISANGPLAVQAILKTIRDTEGMHEEEAF
QVDAALGTEVFKSADAKEGPRAFSEKRAPKFEGR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctctacaacgaccgagaaatccgacatttcggcacagtcgccgcactgcctcgtg
gagaagcgcgggcacgtcctcatcgtcacgatgaaccgccccgaggcgaagaacgcgctg
tccggcgaaatgatggcgatcatgcgggacgcgtgggatcaggtcgactccgacccggac
atccgggtcgccatcctcaccggcgcaggcggcgcattctgcgcgggcgccgacctcaag
gccatgacgtcgcagcaccccggcgactcgttctccggcggcggctgggacctgtccaag
atcgaggcgctcctgaagggacggcgcctcaccaagcccctcatcgccgcagtcgagggt
cccgccatcgccggcggcaccgagatcctgcagggcaccgacatccgcatcgccggagag
agcgccaaattcggtgtctccgaagccaaatggggactcttccccctcggcggctccgcc
gtgcgcctcgtccggcagatcccatacaccgtcgccgccgacatcctgctcaccggacgc
cacatcaaagcccccgaggccaaggagatcggcctcatcggacacgtcgtccccgacggt
caggccctcgacaaggccctcgaactcgccgacctcatctccgccaacggacccctcgcc
gtccaggcgatcctgaagaccatccgcgacaccgaaggcatgcacgaggaggaggccttt
caagtcgacgccgcgctcggcaccgaggtcttcaagagcgccgacgcgaaggaaggcccc
cgcgccttctccgaaaagcgcgcgccgaaattcgagggccgctga

DBGET integrated database retrieval system