KEGG   Rhodococcus jostii: RHA1_ro05185Help
Entry
RHA1_ro05185      CDS       T00382                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
rha  Rhodococcus jostii
Pathway
rha00010  Glycolysis / Gluconeogenesis
rha00052  Galactose metabolism
rha00500  Starch and sucrose metabolism
rha00520  Amino sugar and nucleotide sugar metabolism
rha00521  Streptomycin biosynthesis
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RHA1_ro05185
   00052 Galactose metabolism
    RHA1_ro05185
   00500 Starch and sucrose metabolism
    RHA1_ro05185
   00520 Amino sugar and nucleotide sugar metabolism
    RHA1_ro05185
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    RHA1_ro05185
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    RHA1_ro05185
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     RHA1_ro05185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABG96966
UniProt: Q0S670
Position
complement(5526628..5527515)
Genome map
AA seq 295 aa AA seqDB search
MVALALDIGGTKIAAGIVDADGTVPHPATTPTPATGVADACAALLREVAGAATITSVGIA
CAGPVDTVSGTASPINIDEWSGGFGLVGLVQELFPGVPARLAMDGAAAALGEHHRGAGRG
VPDLLSLVVSTGIGGGVVLGGRIATGRTGNAGHIGHLVVPGGTEPCTCGGVGCLETVASG
PSSVRWARSRGWRGTTGVELARAAADGNDVAVAALDRAGTALGQAIASAAALLDVDLAVI
GGGFAQAGPALWDPMRRAAARHARLSFVADLRVVPAELGAAGTLVGAGVLAVDEG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgcgctggctctcgacatcggcggcaccaagatcgccgccgggatcgtcgacgcg
gacggcacggtgccgcatccggcgaccacccccacgccggcgaccggagtcgcggacgcg
tgcgccgcgctgctgcgggaggttgcgggagcggcgacgatcacgtcggtcggcatcgcc
tgcgccggaccggtcgacacggtctccggcaccgcgtcacccatcaacatcgacgagtgg
tcgggcggcttcggcctggtcggcttggtgcaggaactttttcccggcgtccccgcgagg
ctggcgatggacggcgccgccgccgctctcggcgagcatcaccgcggtgccgggcgcggc
gtccccgacctgctgagtctggtggtgtccaccggcatcggcggcggagtggtcctcggc
ggccgcatcgccaccggccggaccggcaacgccggacacatcggtcacctggtggtcccc
ggcggaaccgagccgtgcacgtgcggcggggtggggtgcctggagacggtggcgagcgga
ccctcgtccgtgcgctgggcccgatcgcggggatggcgcgggacgacgggcgtcgaattg
gcgagggccgccgcggacgggaacgacgtcgccgtggccgccctcgaccgcgcggggacc
gcactggggcaggccatcgcgtccgcggcagccctcctcgacgtcgacctcgcggtgatc
ggtggcggattcgcgcaggccgggcccgcgttgtgggacccgatgcgcagggccgccgcc
cgccacgcccggctgtcgttcgtcgcggatctgcgggtggtcccggcggaactcggcgcc
gccggaaccctcgtcggggcgggagtcctggccgtcgacgagggctga

DBGET integrated database retrieval system