KEGG   Rhodococcus jostii: RHA1_ro05632Help
Entry
RHA1_ro05632      CDS       T00382                                 

Gene name
galU2
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rha  Rhodococcus jostii
Pathway
rha00040  Pentose and glucuronate interconversions
rha00052  Galactose metabolism
rha00500  Starch and sucrose metabolism
rha00520  Amino sugar and nucleotide sugar metabolism
rha01100  Metabolic pathways
rha01130  Biosynthesis of antibiotics
Module
rha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RHA1_ro05632 (galU2)
   00052 Galactose metabolism
    RHA1_ro05632 (galU2)
   00500 Starch and sucrose metabolism
    RHA1_ro05632 (galU2)
   00520 Amino sugar and nucleotide sugar metabolism
    RHA1_ro05632 (galU2)
Enzymes [BR:rha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     RHA1_ro05632 (galU2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75 IspD
Motif
Other DBs
NCBI-ProteinID: ABG97412
UniProt: Q0S4X4
Position
6056107..6057027
Genome map
AA seq 306 aa AA seqDB search
MTDAAPHTASAFRTAVVPAAGMGTRFLPATKTVPKELLPVVDTPGIELVAGEAADSGAGR
LVIVTSPGKDGVVAHFVEDLVLESKLEASGKYHLLEKVRKAPGLLEVESVVQDEPLGLGH
AVGCAESVLDDDEDAIAVLLPDDLVMPRGVLETMSRVRRKRGGTVLCAIDVPKDQVSSYG
VFEVETVPDATNPDVLKVTGMVEKPAIEDAPSTFAAAGRYLLDRAIFDALRRIEPGAGGE
LQLTDAIALLIKEGHPVHVVVHRGTRHDLGNPGGYLRAAVDFALDMDEYGPSLREWLIDR
LKRTDS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgccgcaccgcacaccgccagcgcctttcgcacggctgtcgtgcccgcagcg
ggaatgggcacgcgattcctccccgcgaccaagaccgtgccgaaagagctgctcccggtc
gtggataccccgggtatcgaactcgtggccggagaggccgcggattccggtgccggccgg
ctcgtgatcgtgacgtcgccgggcaaggatggagtggtcgcccacttcgtcgaggatctc
gtgctcgagagcaagctcgaggccagcggcaaatatcacctgctcgagaaggtgcgcaag
gctcccggcctgctcgaggtggagtccgtcgtccaggatgagcctctcggcctgggccac
gcggtcggctgcgcggagtcggtcctcgacgacgacgaggacgccatcgccgtgctcctc
ccggacgacctggtgatgccgcgcggagtgctcgagacgatgtcgcgggttcgccgcaag
cgcgggggcaccgtcctctgcgccatcgacgtccccaaggatcaggtgagctcgtacggc
gtcttcgaggtcgagacggttcccgacgccaccaaccccgacgtcctcaaggtcaccggc
atggtcgagaaaccggccatcgaggatgcgccgtccacgttcgccgccgcaggtcgctac
ctcctcgaccgcgcgatcttcgatgcgctgcggcggatcgaacccggcgccggcggggag
ctccagctcaccgacgccatcgccctcctcatcaaggaaggccatcccgttcacgtcgtc
gtgcaccgaggcacgagacacgatctcggaaatcccggcggctacctccgcgctgcggtt
gactttgcgttggacatggacgagtacggcccgtcgttgcgcgaatggctgatcgaccga
ttgaagcggacggattcctag

DBGET integrated database retrieval system