KEGG   Rhodococcus jostii: RHA1_ro05686Help
Entry
RHA1_ro05686      CDS       T00382                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rha  Rhodococcus jostii
Pathway
rha00071  Fatty acid degradation
rha00072  Synthesis and degradation of ketone bodies
rha00280  Valine, leucine and isoleucine degradation
rha00310  Lysine degradation
rha00362  Benzoate degradation
rha00380  Tryptophan metabolism
rha00620  Pyruvate metabolism
rha00630  Glyoxylate and dicarboxylate metabolism
rha00640  Propanoate metabolism
rha00650  Butanoate metabolism
rha00900  Terpenoid backbone biosynthesis
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
rha01212  Fatty acid metabolism
rha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro05686
   00630 Glyoxylate and dicarboxylate metabolism
    RHA1_ro05686
   00640 Propanoate metabolism
    RHA1_ro05686
   00650 Butanoate metabolism
    RHA1_ro05686
  Lipid metabolism
   00071 Fatty acid degradation
    RHA1_ro05686
   00072 Synthesis and degradation of ketone bodies
    RHA1_ro05686
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RHA1_ro05686
   00310 Lysine degradation
    RHA1_ro05686
   00380 Tryptophan metabolism
    RHA1_ro05686
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RHA1_ro05686
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHA1_ro05686
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RHA1_ro05686
Enzymes [BR:rha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RHA1_ro05686
Exosome [BR:rha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RHA1_ro05686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABG97465
UniProt: Q0S4S1
Position
complement(6107716..6109212)
Genome map
AA seq 498 aa AA seqDB search
MDPTRIPVIVGVGDIRSGRAGDPAAPREPLDLITDAARAALADSGSATLGSRIDAIHAVK
TVSWSYDDLPGLLAARLNLPSPRSSTSPIGGHWPAAFLDRIGDDIAAGRSSAALLVGGEA
QATMTALRKSGTDPASLGWASAPGGPPAFDPADLGSPAMQRAGLIVPTRVYPLFENRVAH
ESGVGPDQSLAESARMYSAFSELAAKNPASWTSEVYSVQEIATVGPGNRMVCEPYPLMLN
AMPFVDQAAAVLVCSLAVARDHGVPEERTVYLWGGAGAADPVDVLSRNGFGTSAAMTNAV
HRALSRASIDASALDIVDAYSCFPVVPKLLTRTLGLPESIVPSVTGGHSFFGGPLNSYTL
HSIAEVTRRLREGAGPALVHGNGGYLTYQHVVLLAGAPHPGGYVGDPEPVQLASEAPELV
TSYEGRADIVTSTVEHGRDGAPATGFVVAHTPDGRRLAGHTGSEEALALSAFAQTPARSV
IGRSVDVTDRDGILSLRF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggatccgacccgcataccggtgatcgtcggagtcggcgacatccgctccggccgagca
ggcgatccggcagccccgcgtgaaccgctcgacctgatcaccgacgccgcgcgtgccgct
ctcgccgacagcggctccgcgaccctgggctcccggatcgacgctatccatgcggtgaag
accgtcagctggtcgtacgacgacctccccggactgctggccgcccggttgaatctgccg
tcaccacgatcgagcacgtccccgatcggcggccactggcccgcggcgttcctcgaccgc
atcggcgacgacatcgccgcgggccggtcgtcggcggcgctcctcgtcggaggcgaggcg
caggcgaccatgacggcgctccggaagtcgggcaccgatcccgcgtcactgggctgggcg
tcggcgccgggcggtccccccgcgttcgacccggcggatctcgggagtcccgcgatgcag
cgcgccggcctgatcgttccgacccgggtgtacccgttgttcgagaaccgggtggcgcac
gagtcgggtgtgggacccgatcagtcgctggccgagtcggcccggatgtattcggcgttc
tccgaactggcggcgaagaacccggcgtcgtggacgtcagaggtgtactccgttcaggag
atcgccacggtgggtccgggcaaccggatggtgtgcgagccgtacccgttgatgctcaac
gccatgccgttcgtcgatcaggccgccgcggtgctggtgtgctcgctggccgtcgcgcgg
gaccacggcgttccggaggagcgcacggtgtacctgtggggcggcgcgggagccgccgac
cccgtggacgtactgagccgcaacggtttcggcacgtccgcggcgatgacgaacgcggtg
caccgggcactgtcgcgggcatcgatcgacgcctcggcactcgacatcgtcgacgcgtac
agctgcttcccggtggtaccgaagctactcacccgcacgctcggcctgcccgaaagcatc
gtgccgagcgtgacgggcggccactcgttcttcggcggtcccctcaacagctacaccctg
cactcgatcgccgaggtcacccgccgacttcgggaaggcgcgggaccggccctggtccac
ggcaacggcggctatctgacgtaccagcacgtcgtgttgctggcaggcgccccgcacccg
ggtggatacgtcggcgatccggagccggtgcagctcgcgtcggaggcgccggaactcgtc
accagctacgaaggacgagccgacatcgtcacatccacggtggagcacgggcgggacggc
gcccccgcgaccggcttcgtcgtcgcgcacacccccgacggccggcgcctggccggacac
accggctccgaggaggcgctcgcactgtccgcgttcgcgcagaccccggcgcggtcggtg
atcgggcggtccgttgacgtcacggaccgcgacggcatcctgtcgctgcggttctga

DBGET integrated database retrieval system