KEGG   Rhodococcus jostii: RHA1_ro06467Help
Entry
RHA1_ro06467      CDS       T00382                                 

Definition
(GenBank) tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
  KO
K00566  tRNA-uridine 2-sulfurtransferase [EC:2.8.1.13]
Organism
rha  Rhodococcus jostii
Pathway
rha04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:rha00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    RHA1_ro06467
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rha03016]
    RHA1_ro06467
Enzymes [BR:rha01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.13  tRNA-uridine 2-sulfurtransferase
     RHA1_ro06467
Transfer RNA biogenesis [BR:rha03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    RHA1_ro06467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_Me_trans ThiI Asn_synthase YadA_head NAD_synthase QueC
Motif
Other DBs
NCBI-ProteinID: ABG98242
UniProt: Q0S2J4
Position
6962274..6963368
Genome map
AA seq 364 aa AA seqDB search
MRVLAAMSGGVDSAVAAARAVAAGHDVVGVHLALSAEPGTLRTGSRGCCSKEDAGDARRA
ADVLGIPFYVWDFADRFKEDVIDDFVASYAAGETPNPCLRCNEKIKFAALADRAIALGFD
AVATGHYAQLENGVLRRAVDADKDQSYVLGVLTAEQLSRAMFPVGDTPKDRIREEAAERG
LAVANKPDSHDICFIPSGDTRAFLGARIGVRPGSVVDADSGEVLAEHEGVHGFTIGQRKG
LGVQGPAADGQPRYVTSIEPDTGTVRVGSARNLEVDAITADRAVWTSGSTPVGPVECTVQ
VRAHGGLAEAVAEAVDGGIAISLREPLTGVAKGQAVVLYRTDPAGDIVLGSGTISGTDAR
PNTQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgcgagtactggcggccatgagtggcggcgtggattccgcggtggcggcggcacgggcg
gtcgcagccggacacgacgtggtgggcgtgcatctcgcgctgtccgccgagccgggcacg
ctgcggaccggatcccggggctgctgctccaaggaggacgccggtgatgccaggcgtgcc
gcggacgtactcggaatcccgttctacgtctgggatttcgccgaccgattcaaggaagac
gtgatcgacgacttcgtggcgtcgtatgccgcgggggagacccccaacccgtgcctgcgg
tgcaacgagaagatcaagttcgcggcgctcgcggaccgtgcgatcgccctcgggttcgac
gcggtggccaccggccactacgcgcaactcgagaacggcgtgctgcgccgtgccgtcgac
gcggacaaggatcagtcgtacgtgctcggtgtgctcaccgccgagcagctgtcgcgggcg
atgttcccggtgggtgacaccccgaaggaccggatccgggaggaggccgccgaacgcggc
ctcgccgtggcgaacaagcccgacagccacgacatctgcttcatcccgtccggcgacacc
cgcgcattcctcggcgcccgcatcggtgtccgtccgggcagtgtggtcgacgccgattcg
ggtgaggtgctggcggaacacgaaggcgtgcacggtttcacgatcggtcagcggaagggt
ctcggcgtccaggggcccgcagccgacgggcaaccgcggtacgtgacgtcgatcgaaccc
gacaccggcaccgtccgtgtcggttccgcccgtaacctcgaggtggacgcgatcacggcg
gaccgcgccgtgtggacgtccgggagcacgccggtcggaccggtcgaatgcaccgtgcag
gtccgggcccacggcggtctcgccgaggctgtcgcggaagcggtcgacggcggcatcgcc
atctcccttcgagagccgctcaccggtgtcgcgaaggggcaggccgtcgtcctgtaccgg
accgatccggcaggcgacatcgtgctgggcagcggaacgatctcgggtaccgacgcacgt
ccgaacacacagtga

DBGET integrated database retrieval system