KEGG   Rhodococcus jostii: RHA1_ro06605Help
Entry
RHA1_ro06605      CDS       T00382                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
rha  Rhodococcus jostii
Pathway
rha00860  Porphyrin and chlorophyll metabolism
rha01100  Metabolic pathways
Module
rha_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RHA1_ro06605
Enzymes [BR:rha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     RHA1_ro06605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO MobB DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: ABG98378
UniProt: Q0S258
Position
7100704..7102242
Genome map
AA seq 512 aa AA seqDB search
MSESRWKGALLVAGTTSDAGKSVLVAGLCRMLARRGVRVAPFKAQNMSNNSVVTLDGGEI
GRAQALQAAACGLEPSVRFNPVLLKPGSDRTSQLVVRGRAVTSVGARDYIEHRQHLRAVV
AEELASLRADYDVVICEGAGSPAEINLRATDLANMGLARAAGLPVIVVGDIDRGGVLAHL
FGTVAVLGPDDQALIAGFVINKFRGDVSLLGPGLEQLTAVTGRPTLGVIPFAEDLWLDAE
DSLGVVGDAPVGRPAPPIGDDWLRVAAIRLPRISNSTDVEALACEPGVSVRWITDPSRLQ
DTDLIVLPGSKSTVSDLEWLRRNGIADAIAAHAKRGGPVLGVCGGYQMLGSVIVDDVESG
RGAVPGLGLLDLEVEFAPDKVLAQVRGNAHGVPVSGYEIHHGRVRRNGDQPLLHASSGAA
EGSIRGAVYGTHWHGLLETDRFRRLLLDDVAEHAGRTGFVTAPDTDVAAIRTAQLDLLAD
LVEQNLDLRALEDLLGAGAPEGLPAIASTLVS
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagagcaggtggaagggcgccctgctcgtcgccggcaccacgtccgacgcgggc
aagagtgtgctcgtcgcgggactgtgccggatgctcgcgcggcgaggtgtccgggtggcg
ccgttcaaggcgcagaacatgtcgaacaattccgtcgtcacgctggacggcggcgagatc
ggccgggcgcaggctctgcaggccgcggcctgcggactcgagccgagtgtccgcttcaac
cccgtcctgctgaaaccggggagcgaccgcacgtcgcaactggtggtgcgcggccgcgcg
gtcacgtccgtcggcgcccgcgactacatcgagcatcggcagcacctgcgtgcggtggtg
gccgaggaactggcgtcgctgcgcgccgactacgacgtcgtgatctgtgagggcgcgggg
tcacccgccgagatcaacctgcgagccaccgacctcgccaacatggggctcgcccgggcc
gccggcctgccggtgatcgtcgtcggcgacatcgaccgcggtggagtgctcgcccacctg
ttcggcaccgtggcggtcctcggaccggacgaccaggcgttgatcgcgggattcgtgatc
aacaagttccgcggcgacgtgtcgttgctggggccgggcctcgagcagctgacggccgtg
acgggacgcccgacgctcggggtgattcccttcgccgaggacctgtggctcgacgcggag
gattcgctcggtgtcgtgggggacgccccggtcggacgtccggcgccaccgatcggcgac
gactggctgcgggtggccgcgatccgcctgccccgcatctccaattcgacggacgtcgag
gcgctcgcgtgcgaacccggggtgtcggtgcgctggatcaccgatccgtcgcggctgcag
gacaccgacctgatcgtcctgcccgggagcaagtcgaccgtgtcggatctggagtggttg
cgccgcaacggcatcgcggatgcgatcgcagcgcatgcgaaacgcggcggtccggtgctc
ggcgtgtgtggcggctaccagatgctcgggtccgtgatcgtcgacgacgtcgaatccggc
cggggtgcggtgcccggtctcggactgctcgacctcgaggtggagttcgccccggacaag
gtgctcgcgcaggtgcgcggcaacgcccacggagttccggtgtccgggtacgagatccat
cacggccgggtgcggcgcaacggcgaccagcccctgctccacgcgagcagcggcgccgcg
gaaggcagtatccgcggcgccgtctacggcacgcactggcacggactgctcgagaccgac
cgtttccgccgcctcctgctggacgatgtggccgaacacgcggggagaaccggtttcgtc
accgcacccgacacggatgtcgccgcgatccggaccgctcaactcgatctgttggcggat
ctggtggagcagaacctcgatctccgcgccctggaggacctcctcggcgcaggcgccccg
gaaggcctcccggccatcgcgtcgaccctggtgagttag

DBGET integrated database retrieval system