KEGG   Rhodococcus jostii: RHA1_ro06612Help
Entry
RHA1_ro06612      CDS       T00382                                 

Definition
(GenBank) malate dehydrogenase (acceptor)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
rha  Rhodococcus jostii
Pathway
rha00020  Citrate cycle (TCA cycle)
rha00620  Pyruvate metabolism
rha01100  Metabolic pathways
rha01110  Biosynthesis of secondary metabolites
rha01120  Microbial metabolism in diverse environments
rha01130  Biosynthesis of antibiotics
rha01200  Carbon metabolism
Module
rha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RHA1_ro06612
   00620 Pyruvate metabolism
    RHA1_ro06612
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     RHA1_ro06612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABG98385
UniProt: Q0S251
Position
7107738..7109282
Genome map
AA seq 514 aa AA seqDB search
MDKEVDTPVSDQNAVETRTDVVLVGAGIMSATLGAILRQVQPDWSITTFERLDAVAAESS
DPWNNAGTGHSALCELNYTPQNADGTVDITKAVNVNEQFQVSRQFWAHGVESGVLTQPKE
FINPIPHVSFVHGEANAKYLRARYDALAGHPLFAGMEYIDAPDEFTRRLPLMAKGRDFSD
PVALNWTQDGTDVDFGALTKQLLGYVGASGGVVHFGHEVTDLTKQSDGSWVVKVTNRRNG
VKKVVRAKFVFVGAGGGALHLLQKSGIEEAKGFGGFPVSGAFLRCTNPELIDQHRAKVYG
KAAVGAPPMSVPHLDTRVIGNKPGLLFGPYAGWSPKFLKQGRVTDLPSSVKPDNLLSMLG
VGVSELGLVKYLISELAMSEAGRIETLREFVPKALGKDWELITAGQRVQVIRRAKGKGGV
LEFGTAVVNAADGTIAGLLGASPGASTAVPAMLDVLQRCFPAQYESWKPKLQEMVPSLGV
KLSDDTALFSQVWDWTSKVLQLDTSKVEDASVAV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggaagtcgatactccagtgtcagatcagaatgcggtagagacgagaacggat
gtagtgctggttggcgcgggcatcatgagcgcgacgctgggagcgatcctgcgtcaggtg
cagcccgattggtcgatcaccacattcgagcggctcgacgcagtagccgccgagagcagc
gacccgtggaacaacgcgggcaccggccactccgcgctgtgtgagctcaattacactccg
cagaacgccgacggcaccgtggacatcacgaaggctgtcaacgtgaacgagcagttccag
gtgtcgcggcagttctgggcgcacggtgtcgagagcggtgtgctgacgcagcccaaggag
ttcatcaaccccatcccgcacgtgagcttcgtgcacggcgaggccaacgcgaagtacctg
cgggcccgctacgacgccctcgccggtcaccccctgttcgcgggcatggagtacatcgac
gcacccgacgagttcacccgtcgcctgccgctgatggcgaagggccgcgacttcagcgat
cccgtcgccctcaactggacccaggacggcaccgacgtcgatttcggcgccctgaccaag
cagctcctcggttacgtcggcgcgtccggcggcgtcgtccacttcgggcacgaggtcacc
gacctcaccaagcagtccgacggcagctgggtggtcaaggtcaccaaccgccgcaacggt
gtgaagaaggtcgtgcgcgccaagttcgtgttcgtcggcgccggcggcggtgcgctgcac
ctgctgcagaagtccgggatcgaggaggccaagggcttcggcgggttccccgtcagcggc
gccttcctgcgctgcaccaacccggagctcatcgaccagcaccgcgccaaggtctacggc
aaggccgccgtcggcgcaccgcccatgtcggttccgcacctcgacacccgcgtgatcggc
aacaagcccggactgctgttcgggccgtacgccggctggtcgcccaagttcctcaagcag
ggccgcgtcaccgacctgcccagctcggtcaagccggacaacctgctctcgatgctcggt
gtcggcgtcagcgaactcggtctcgtcaagtacctgatcagtgagctcgcgatgtccgag
gccggccggatcgagaccctgcgggagttcgtcccgaaggcgctcggcaaggactgggaa
ctgatcaccgccggccagcgcgtccaggtcatccgtcgagccaagggcaagggcggcgtt
ctcgaattcggcaccgccgtcgtcaacgccgccgacggcaccatcgcgggcctgctcggc
gcgtcgccgggtgcgtcgaccgcggtgcccgccatgctcgacgtgctgcagcgctgcttc
ccggcccagtacgagtcgtggaagccgaagctccaggagatggttccgtcgctgggcgtc
aaactctccgacgacaccgcgctgttctcgcaggtgtgggactggacatcgaaggtgctc
cagctcgacaccagcaaggtggaggacgcgtcggtcgcggtctga

DBGET integrated database retrieval system