KEGG   Rhodococcus jostii: RHA1_ro08054
Entry
RHA1_ro08054      CDS       T00382                                 

Gene name
bphB
Definition
(GenBank) cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Organism
rha  Rhodococcus jostii
Pathway
rha00621  Dioxin degradation
rha01100  Metabolic pathways
rha01120  Microbial metabolism in diverse environments
rha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    RHA1_ro08054 (bphB)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.56  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
     RHA1_ro08054 (bphB)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase 3Beta_HSD TrkA_N Shikimate_DH
Other DBs
NCBI-ProteinID: ABG99101
UniProt: Q0S035
Position
pRHL1:complement(51782..52597)
AA seq 271 aa
MGWLEDNVMIVTGGGSGLGRALVERFLGEGARVGVLEKSAEKAEKLANDFGEDVLVVEGD
VRKYDDNARVVQETVRQFGRLDTFVANAAIWDFSTKMVDIPVDRLDALFDEMFHINVKGY
LHGARAAVEELAATGGSIIYTVSNAGFYPGGGGPLYTASKHAVVGLIKELAFELGPKIRV
NGVAPGAMPTDLRGPGSLGMGETTITSAVSLGDLVKQCTVLQELPEAADYTGHYVLLASK
ANSRTATGAIINCDGGMGVRGLAETAGGNDL
NT seq 816 nt   +upstreamnt  +downstreamnt
atgggttggctggaagacaacgtcatgatcgtcaccggcggagggtcgggcctaggccgg
gcgctggtcgagcgattcctgggagagggagcccgggtgggtgtcctggagaagtcggcg
gagaaggctgagaagcttgccaacgacttcggcgaggatgtcctcgtggtcgaaggcgac
gtgcgcaagtacgacgacaatgcgcgcgtcgtccaggaaacggttcgccagttcggtcgc
ctcgacacgttcgtcgcgaacgccgcgatctgggacttctcgacgaagatggtcgatatc
ccggtggaccgactggacgccctcttcgacgaaatgttccacatcaacgtcaagggctac
ttgcacggtgcacgtgcggcggtcgaggagctcgccgccaccggaggctcgatcatctac
accgtgtcgaacgccggcttctaccccggcggcggcggcccgctctacaccgcgtcgaag
cacgcggtagtcgggctgatcaaggaactggccttcgaactcggccccaagatccgcgtc
aacggggtggctccgggcgcaatgcccaccgatctgaggggacctggttcgctcggaatg
ggcgaaaccaccatcacctcagcggtatccctcggtgatctggtcaaacagtgcacagtg
ctgcaggagctgcccgaggctgcggactacaccgggcactacgttctgctggcttcgaag
gcgaactcgaggacggcaaccggcgcgatcatcaactgtgacggcgggatgggtgtgcgc
ggcttggccgagacggccggcggaaacgacctgtaa

DBGET integrated database retrieval system