KEGG   Rhodococcus jostii: RHA1_ro08058
Entry
RHA1_ro08058      CDS       T00382                                 

Gene name
bphAc
Definition
(GenBank) biphenyl 2,3-dioxygenase, ferredoxin component
  KO
K18087  biphenyl 2,3-dioxygenase ferredoxin component
Organism
rha  Rhodococcus jostii
Pathway
rha00621  Dioxin degradation
rha01100  Metabolic pathways
rha01120  Microbial metabolism in diverse environments
rha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    RHA1_ro08058 (bphAc)
SSDB
Motif
Pfam: Rieske Rieske_2
Other DBs
NCBI-ProteinID: ABG99105
UniProt: Q53124
Position
pRHL1:complement(55137..55466)
AA seq 109 aa
MTMALTKICSSGDLAPGEMLRFEEGPEPILVCNVGGEFFATQDTCSHADWALSEGYLEDD
VVECTLHWAKFCVRTGKAKALPACVPLRTFVVKLEGDDVLVDLEGGVTT
NT seq 330 nt   +upstreamnt  +downstreamnt
gtgacgatggccctcacaaagatatgcagctccggcgatttggcgccgggtgagatgctt
cgcttcgaggaaggtccagagccgattctggtctgtaacgtgggcggagagttcttcgcg
actcaggacacctgcagccatgccgattgggcactctcagagggctatctcgaggatgac
gtcgtggagtgcacactccactgggccaagttctgcgtgcgcaccggcaaggcgaaggct
ctccccgcctgtgttccgttgcggacctttgtggtcaaactcgagggagacgacgttctc
gtggacctcgagggcggagtgacgacatga

DBGET integrated database retrieval system