KEGG   Rhodococcus jostii: RHA1_ro08084Help
Entry
RHA1_ro08084      CDS       T00382                                 

Gene name
bphG3
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
rha  Rhodococcus jostii
Pathway
rha00360  Phenylalanine metabolism
rha00362  Benzoate degradation
rha00620  Pyruvate metabolism
rha00621  Dioxin degradation
rha00622  Xylene degradation
rha00650  Butanoate metabolism
rha01100  Metabolic pathways
rha01120  Microbial metabolism in diverse environments
rha01220  Degradation of aromatic compounds
Module
rha_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
rha_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:rha00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RHA1_ro08084 (bphG3)
   00650 Butanoate metabolism
    RHA1_ro08084 (bphG3)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    RHA1_ro08084 (bphG3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RHA1_ro08084 (bphG3)
   00622 Xylene degradation
    RHA1_ro08084 (bphG3)
   00621 Dioxin degradation
    RHA1_ro08084 (bphG3)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     RHA1_ro08084 (bphG3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA DapB_N
Motif
Other DBs
NCBI-ProteinID: ABG99131
UniProt: Q0S005
Position
pRHL1:complement(83338..84321)
Genome map
AA seq 327 aa AA seqDB search
MSENTRKVTVAVIGSGNIGTDLMIKVIRHSEVLQMGAMVGIDPDSDGLARARRLGVPTTS
DGVQGLLQLPNFDEIDVIFDATSAKAHEANAALLEPLGKRLIDLTPAALGPFVVPAVNLD
EHRDAANVNMVTCGGQATIPIVAAVSRVTPVAYAEIVASIASKSAGPGTRANIDEFTETT
SHAIETVGGARRGKAIIILNPADPPLIMRDTVLCLISAPDPATHDAIRDSIQTMVDHVAT
YVPGYRLKQQVQITPVPDGQPVRTLLASGDAATPTHQVSVFLEVEGAAHYLPAYAGNLDI
MTSAAVRYAESVADTIAAPTAAQGATR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaacacccgtaaggtcaccgtcgcggtgatcggatccggcaacatcggcacc
gacctgatgatcaaggtgatccgccactccgaggtcctgcagatgggcgcgatggtcggt
atcgaccccgactccgacgggctcgcccgtgcccgccgactcggcgtccccaccacctca
gatggcgtccaaggcctccttcagctgccgaacttcgacgagatcgacgtcatcttcgac
gccacctccgccaaggcacacgaggccaacgccgccctgctcgaaccgctcggcaaacgg
ctgatcgacctcaccccggccgccctcggccccttcgtggtgccggcggtcaacctcgac
gaacaccgcgacgccgccaacgtcaacatggtcacctgcggcggtcaggccaccatcccg
atcgtcgccgccgtctcccgcgtgacaccggtcgcctacgccgaaatcgtcgcctccatc
gcctcgaagtccgccggaccaggcacgcgcgcgaacatcgacgagttcaccgaaaccacc
tcccacgcaatcgaaaccgtcggaggtgcccgccgcggcaaggccatcatcatcctcaac
ccggccgacccgccgctgatcatgcgcgatacggtcctgtgcctgatctccgcccccgac
ccggccacccacgacgccatccgcgattcgatccagacgatggtcgaccacgtcgcgacc
tacgtgcccggctaccgactcaagcaacaagtccagatcacgccggtcccggacggccaa
cctgtgcgcaccctgctcgcgtccggggacgcggctacaccgacgcatcaggtgtcggtg
ttcctcgaagtcgaaggcgccgcgcactatctgccggcctacgccggaaacctcgacatc
atgacctcggccgcagtgcgctacgccgagtccgtcgccgacacgatcgccgccccgacg
gcagcacagggagccacccgatga

DBGET integrated database retrieval system