KEGG   Rhodococcus jostii: RHA1_ro08632
Entry
RHA1_ro08632      CDS       T00382                                 

Gene name
limC2
Definition
(GenBank) (+)-trans-carveol dehydrogenase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
rha  Rhodococcus jostii
Pathway
rha00903  Limonene and pinene degradation
rha01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    RHA1_ro08632 (limC2)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     RHA1_ro08632 (limC2)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind DUF1122 HisKA
Other DBs
NCBI-ProteinID: ABG99676
UniProt: Q0RYG0
Position
pRHL1:complement(610819..611661)
AA seq 280 aa
MTGRLADKVAFITGAARGQGRSHAERLAEEGADIIAVDICGEVGRTTNFYPAATEEDLAE
TVRLVEKHGRRIIAYTADVRDFTALEAGLSSAVAELGRLDIVAANAGIFQFGVEVPDIPV
DDWRDVIDVNLTGVFNTCKAAVPHIVDGRRGGSVVITSSDAGVKGFARFGHYVASKHGVI
GLMRTLTMELAPHSIRVNVVAPTNCNTDMIQNDAVWKLFRPDRENPTFEEFAEASSTLLA
LPEPWVEPADVSNALLFLASDEARFITGVTLPVDGGSAAI
NT seq 843 nt   +upstreamnt  +downstreamnt
atgaccggacgactagcagacaaggttgccttcattaccggcgccgcccgcggccaaggc
cgcagtcacgcagaacgcctggccgaagaaggcgcggacatcatcgccgtcgacatctgc
ggagaggtcggccgaaccaccaacttctaccccgccgccaccgaagaggacctcgccgag
acagtccggctcgtcgaaaagcacggacgccgaatcatcgcctatacagcggacgttcgt
gatttcactgccctcgaggccgggctctcctccgccgtcgccgaactcggccgactcgac
atcgttgcagcgaacgcagggatcttccagttcggtgtcgaggtccccgatatccccgtc
gacgactggcgcgacgtcatcgacgtcaacctcaccggcgtcttcaacacctgcaaggca
gccgtcccacacatcgtcgacggtcgccgcggcggctccgtcgtcatcacctcatcggac
gccggcgtcaaggggttcgcccgattcggccactatgtggcgtccaaacacggcgtcatc
ggactcatgcgcacactcaccatggaacttgcaccgcattccatccgcgtgaatgtcgtg
gcacccacgaactgcaacaccgacatgatccagaacgacgccgtttggaaactcttccgc
cccgaccgcgagaacccgaccttcgaggaattcgcggaggcatcgtcgaccctgctggcg
ctacccgagccttgggtcgagcctgccgacgtctccaatgcactgctgttcctcgcctcg
gacgaggcccggttcatcacgggcgtgacgctaccggtggacggtgggtccgccgcgatc
tga

DBGET integrated database retrieval system