KEGG   Rhodococcus jostii: RHA1_ro10126
Entry
RHA1_ro10126      CDS       T00382                                 

Gene name
bphB2
Definition
(GenBank) cis-3-phenylcyclohexa-3,5-diene-1,2-diol dehydrogenase
  KO
K08690  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase [EC:1.3.1.56]
Organism
rha  Rhodococcus jostii
Pathway
rha00621  Dioxin degradation
rha01100  Metabolic pathways
rha01120  Microbial metabolism in diverse environments
rha01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    RHA1_ro10126 (bphB2)
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.56  cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase
     RHA1_ro10126 (bphB2)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR F420_oxidored Shikimate_DH TrkA_N Epimerase NAD_binding_2 RHH_6 HMA 3Beta_HSD
Other DBs
NCBI-ProteinID: ABH00319
UniProt: Q75T42
Position
pRHL2:117026..117838
AA seq 270 aa
MGWLEGNVAVITGGGSGLGRALVERFIEEGAKVGVLERSAEKVKKLAADFGENVVTVEGD
VSKYEDNASVVRETVRQFGRLDTFVGNAAIWDFSTKLVDIPEDRLDPLFDEMFHINVKGY
LNGAKAAVKELALTGGSIVFTVSNAGFYPGGGGPLYTASKHAVVGLVKELAFEFAPKIRV
NGVAPGAMATDLRGPGSIGLGETNVSSLPLADLIKQCTVLQELCEPADYTGHYVLLASKD
NSRTATGAIINCDGGMGVRGLAETAGGNDL
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggttggctagaaggcaacgttgcggttatcaccggtggcggatcgggcctgggtagg
gcgctggttgagcgattcatcgaggagggcgcaaaagtaggagtcctggagaggtcggcg
gagaaggtcaagaagcttgcggctgatttcggcgagaatgtcgtcactgtcgagggcgac
gtgagcaagtacgaggacaacgcttcggtcgtgcgagaaacggtgcgacagttcggccgc
ctcgacaccttcgtgggtaacgcggcgatctgggacttttcgacaaagctggtcgacatc
ccggaggacagactggacccgctcttcgacgagatgttccacatcaacgtcaagggctat
ctgaacggggcgaaagcggcagtcaaggagcttgcactcacaggtggttcgatcgtcttc
acggtgtccaacgccggtttctacccaggtggcggcgggccgctgtacacggcctcgaag
cacgcggtcgtgggtctggtcaaggaactggccttcgaattcgcccccaaaatccgagta
aacggagtggcccctggtgccatggccacggatctgcgcgggccaggatcgatcggactc
ggcgaaacgaacgtctcgtccctcccgctcgcagatctgatcaagcagtgcacggtactg
caggaactctgtgagcccgcggattacactgggcactacgtcctgctcgcctcgaaggat
aattcacgaaccgcgactggtgcgatcatcaactgtgacggcggaatgggcgtacgcggc
ctcgccgaaaccgcaggcggaaatgacctttag

DBGET integrated database retrieval system