KEGG   Rhodococcus jostii: RHA1_ro10267Help
Entry
RHA1_ro10267      CDS       T00382                                 

Definition
(GenBank) probable Zn-containing alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rha  Rhodococcus jostii
Pathway
rha00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    RHA1_ro10267
Enzymes [BR:rha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     RHA1_ro10267
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     RHA1_ro10267
    1.1.1.-  
     RHA1_ro10267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 Pyr_redox_3 Shikimate_DH DAO adh_short
Motif
Other DBs
NCBI-ProteinID: ABH00460
UniProt: Q0RW76
Position
pRHL2:257147..258208
Genome map
AA seq 353 aa AA seqDB search
MLALRLYREHDARLEEVPEPELRPGAVKVKVAWAGICGSDLSLFETAPVPLDYSNPIMQE
TGPHTLGHEFSGYVTEVAEGVTTVQVGDLVAVRPNFADGTCPSCQAGHPNMCDNFAFIGI
NGWGGGFSESVVVPADHAYVLPPGFNAQIAALIEPLTVAWHAVKLAEIPKDGTALVVGAG
PIGLSTVLALRAQGISKIIVSEPSEARKKLAAEVGADLVIDPRETDVVAAVRDATGGRGA
DVSFEASGIGKATLQPAIDALCTAGRAVILASFHGDVPTDVMPFLTKEKVLTGSFAYTAQ
DFSDVRDAVVDGRITPDALISSRIQLSDVLDSGIKHLLGEGRTTEVKILVSPS
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcttcggctttatcgtgaacacgatgcacggctggaggaggttccggaacca
gaactgcgtccaggagcggtcaaggtcaaagttgcctgggccggaatctgcgggtcggac
ctctccttgttcgaaactgcgccagtccccctcgactactcgaacccgatcatgcaggag
acaggacctcatacactcggacacgagttctctgggtatgtcaccgaagtcgcagagggc
gtcacaaccgtgcaggtgggtgacctggtggcggttcgcccgaattttgccgacggcacc
tgtccctcctgccaggcggggcatccgaatatgtgcgacaacttcgctttcatcggaatc
aacggctggggtggcggattcagcgagagcgtagtcgtgcccgcagaccacgcgtatgtg
ctcccgccggggttcaatgcacagatcgctgcattgatcgaaccgcttaccgtcgcttgg
cacgccgtcaaattggcggagattcccaaggatggaaccgcactcgtcgtgggcgccggt
ccgatcggcctaagcacagtactggcattgcgagctcagggcatatcgaagatcatcgtc
agcgagcccagcgaagcgcggaagaagctcgccgcagaagtcggcgctgacctggtcatc
gacccccgggaaacagacgtcgtcgccgcagtccgcgacgcgaccggtggacgcggcgcc
gatgtttcgttcgaggcctccgggatcggcaaggctacgctgcagcctgccatcgatgcg
ctgtgcacggcagggcgtgcggtgatcttggcgagcttccatggcgacgttccgacggat
gtaatgccgttcctcactaaggagaaggtgcttaccggcagtttcgcctataccgcccag
gatttttccgacgtccgtgatgccgttgttgatggccggatcacgccagatgcgctcatc
agtagccgaattcaactgtcggatgtgctcgactctggaatcaaacaccttctcggcgag
ggacgtacgaccgaggtgaagattctcgtgtctccctcatag

DBGET integrated database retrieval system