KEGG   Rhodococcus sp. B7740: NY08_28Help
Entry
NY08_28           CDS       T03776                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, - and -acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rhb  Rhodococcus sp. B7740
Pathway
rhb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rhb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NY08_28
Enzymes [BR:rhb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NY08_28
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NY08_28
    1.1.1.-  
     NY08_28
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_N_assoc ADH_zinc_N_2 Adhesin_Dr NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AJW38061
UniProt: A0A0D5A5C9
Position
22819..23892
Genome map
AA seq 357 aa AA seqDB search
MRAAVFHDRHDVRVEDVPAPKVGPGEVLLRPFFCGICGTDLHEYAFGPIVIPTEPHALTG
AKAPQVFGHEFSARVVEIGSDVTSVAVGDRVSVMPLVTCGKCYYCRRGLNHLCVIMACTG
LSWGGGGISELVAVQEQQVSVLPDSVSDVQGALIEPAAVAAYGVDCTGLRAGDTILITGA
GPIGALSALYAHASGAAKIIVSEPNAKRRALIEAFGIAEVLDPTVQDVPAAVLALTGGIG
VDAAAECSGHQHGLTAALGSVRSGGTVAQVGLHVKPATIDPMAMSNKDLTLVGTWCYPVY
DWPRIIALVASGRYPVEKVVSEIIDVENIVADGFERLLDPNGDAQKLLVRVGDAPAS
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgcggtatttcacgaccgacacgatgtacgggtagaagacgttccggccccg
aaggtcggccccggcgaggttctgcttcgtccgttcttctgcggcatctgcggaacggac
ctgcacgagtacgccttcggtccgatcgtcattccgaccgaaccccacgcactcaccggc
gcgaaagccccgcaggtgttcggccacgaattctcggcgcgcgtggtcgagatcggctcc
gacgtgacgtcggtcgcggtgggcgatcgcgtgtcggtgatgccgctcgtcacctgcggc
aagtgctactactgccgacgcgggctcaaccacctgtgtgtgatcatggcctgcaccggg
ttgagctggggcggcggaggaatctccgaactggttgcggtgcaggaacaacaggtatcg
gtgcttccggacagcgtcagtgacgtccagggcgctctcatcgagccggcagcggtggcc
gcttacggtgtcgactgcaccggcctgagagcaggcgacaccatcctcatcaccggtgcg
ggaccgatcggtgccctgtccgctctgtacgcacacgcatcgggtgcggcgaagatcatc
gtgtccgagccgaatgccaagcgccgcgcgctgatcgaggcattcggcatcgccgaggta
ctggaccccaccgtgcaggacgtgcccgccgcggtcctcgcactgaccggcggtatcggg
gtcgatgccgcagcggaatgctcgggtcaccagcacggactgacggccgcactcggcagc
gttcgctccggcggaaccgtcgcccaggtcggactgcacgtcaagccggccacgatcgat
ccgatggccatgtccaacaaggacctgactctggtgggtacctggtgctacccggtgtac
gactggccgcgcatcatcgccctggtcgcatccggacgctacccggtggagaaggtcgtc
agcgagatcatcgacgtcgagaacatcgtcgccgacggattcgagcggctgctcgacccg
aacggtgacgcccagaagcttctggttcgggtcggcgacgcaccggcgtcctga

DBGET integrated database retrieval system