KEGG   Rhodococcus sp. B7740: NY08_4017Help
Entry
NY08_4017         CDS       T03776                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhb  Rhodococcus sp. B7740
Pathway
rhb00071  Fatty acid degradation
rhb00072  Synthesis and degradation of ketone bodies
rhb00280  Valine, leucine and isoleucine degradation
rhb00310  Lysine degradation
rhb00362  Benzoate degradation
rhb00380  Tryptophan metabolism
rhb00620  Pyruvate metabolism
rhb00630  Glyoxylate and dicarboxylate metabolism
rhb00640  Propanoate metabolism
rhb00650  Butanoate metabolism
rhb00900  Terpenoid backbone biosynthesis
rhb01100  Metabolic pathways
rhb01110  Biosynthesis of secondary metabolites
rhb01120  Microbial metabolism in diverse environments
rhb01130  Biosynthesis of antibiotics
rhb01200  Carbon metabolism
rhb01212  Fatty acid metabolism
rhb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NY08_4017
   00630 Glyoxylate and dicarboxylate metabolism
    NY08_4017
   00640 Propanoate metabolism
    NY08_4017
   00650 Butanoate metabolism
    NY08_4017
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NY08_4017
   00072 Synthesis and degradation of ketone bodies
    NY08_4017
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NY08_4017
   00310 Lysine degradation
    NY08_4017
   00380 Tryptophan metabolism
    NY08_4017
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NY08_4017
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NY08_4017
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NY08_4017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhb04147]
    NY08_4017
Enzymes [BR:rhb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NY08_4017
Exosome [BR:rhb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NY08_4017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJW42022
UniProt: A0A0D5AFV6
Position
complement(4120054..4121262)
Genome map
AA seq 402 aa AA seqDB search
MEAFLYDAVRSPRGRGKSSGSLHTVKPVDLAANTLSTLLSRHSQLDPALIDDIVLGVVTP
VGDQGCDIARTVAMAAGLPDSVAGVQLNRFCGSGLEAVNTAAQRVRSGWDRLIVAGGVES
MSRVPLGADGGAWPCDPLTNYGSYFVPQGVSADLIATIEGFDRDEVDAYAVRSQQRAAHA
WSMGHFEKSVIPVFDANGRLMLDHDEIMRPETTTADLAALTPSFAQMGSLAGFDAVAMQK
YTEVERIDHVHHAGNSSGIVDGTAMVLIGSEEAGRAGGLTPRGRVVAGVVAGSDPTLMLT
GPVPATHKVLAAAGLGLDDIAVFEVNEAFASVVLNYAKKLDIDHERINVNGGAIAMGHPL
GATGAMLTGMALDELERRGERYALITLCIGAGMGVATIIERL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggaggcattcctctacgacgcagtgcgcagcccacgtggccgcggcaagagctccggc
tcactgcacaccgtcaagccggtcgacctcgccgcgaacacgttgtccacgttgctctct
cgacactcccagctcgatccggccctgatcgacgacatcgtgctcggtgtcgtcaccccg
gtcggcgatcaaggctgcgacatcgcccgaaccgtcgcgatggcggccggcctaccggac
agcgtggccggcgttcagctcaaccgcttctgcggatcggggctcgaggccgtcaacact
gcggcgcaacgtgttcggtccggatgggatcggctcatcgtcgccggtggcgtcgaatcg
atgtctcgtgtgccgctcggggcggacggcggcgcgtggccgtgcgacccgctgaccaac
tacggcagctacttcgtcccacagggagtcagcgcagatctcatcgcgacgatcgagggg
ttcgatcgggacgaggtcgacgcctacgcggtacgtagccagcaacgagcggcgcatgcc
tggtcgatgggccacttcgagaagtcggtcatccccgtcttcgacgccaacggccggctg
atgctcgatcacgacgagatcatgcgacccgagaccaccactgccgacctcgccgccctg
acaccatcgttcgcacagatgggttcgctcgccgggttcgacgccgtcgcgatgcagaag
tacaccgaggtcgagcgcatcgatcacgtacaccacgccggtaactcctccggcatcgtc
gacggcaccgcgatggttctcatcggctccgaagaggccggtcgcgcaggcggattgacc
ccacgcggacgcgtcgtggccggggtcgtcgccggatcggacccgacgctgatgctcacc
ggcccggttccggccacccacaaggtgttggccgcggcgggactgggtctcgacgacatc
gcggtgttcgaggtcaacgaggcattcgcttcggtggtgctcaactacgcgaagaagctg
gacatcgaccacgagcgcatcaacgtcaacggcggcgcgatcgcgatgggccacccactg
ggcgcaacgggagcgatgctcaccggaatggctctcgacgagctcgagcgccggggcgag
cgctatgcgctgatcacgctctgcatcggtgccggaatgggcgtcgccaccatcatcgag
cgcctgtga

DBGET integrated database retrieval system