KEGG   Rhodococcus sp. B7740: NY08_4366Help
Entry
NY08_4366         CDS       T03776                                 

Definition
(GenBank) Threonine dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
rhb  Rhodococcus sp. B7740
Pathway
rhb00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:rhb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NY08_4366
Enzymes [BR:rhb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NY08_4366
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NY08_4366
    1.1.1.-  
     NY08_4366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AJW42366
UniProt: A0A0D5AHN7
Position
4477410..4478468
Genome map
AA seq 352 aa AA seqDB search
MRAAVYYGPNKVEITDVPEPSPGEGQVKVKVGFNGICGTDLHEYYAGPIFIPTSPHPLTG
QEMPLVLGHEFSGTVTELGKGVTGIAVGDRVAIEPLYRCGHCGPCRAGNYNICAQIGFHG
LMSDGGMAEYTVVPTDMIHALPDNVSLELGALVEPMSVAYHAATLGDPKPEDTAMVFGAG
PIGIGLWFALRGKGLDNVYVVEPSPTRRASIEALGAKTLDPTAVDVPAFIADLTDGNGAD
AIYDAAGVQPAVETALGCIGARKPLVSVAIYEKPLTTPLQKLVMNESRIQGSLCYTAADY
EAVIDLMSQGHYDTTGWVDKITLDGVIDDGFEALHAGTKMKVLVDPSTGAAS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagctgtgtattacggaccgaacaaggtggagatcaccgacgttcccgagccc
agtcccggtgaaggccaggtcaaggtcaaggtcgggttcaacggaatctgcggaaccgac
ctgcacgagtactacgcgggccccatcttcatccccacctcgccgcatccgctgaccgga
caggagatgccgctggtgctgggccacgagttctcgggaacggtcaccgagctcgggaag
ggcgtgaccggcatcgcggtgggcgaccgcgtggccatcgagccgctgtaccgctgcggc
cactgcggaccgtgccgggccggcaactacaacatctgcgcgcagatcggtttccacgga
ctgatgtccgacggcggaatggccgagtacaccgtggtacccaccgacatgatccacgcc
ttgcccgacaacgtctccctcgaactcggagccctcgtcgaaccgatgtcggtcgcctat
cacgctgcgacactgggagatccgaagcccgaggacaccgcgatggtgttcggagccggc
cccatcggcatcggactgtggttcgccctgcgcggtaagggtctcgacaacgtctacgtc
gtcgagccctcgccgacgcgtcgagcatcgatcgaagcactcggtgcgaagacactcgat
ccgacggccgtcgacgtccccgcgttcatcgccgacctcaccgacggcaacggggccgac
gccatctacgacgcggcaggcgtgcaacctgccgtcgagaccgccctcgggtgcatcgga
gcgcgtaagccgctggtcagcgtcgcgatctacgaaaagccgttgaccacaccgctgcag
aagctggtgatgaacgaatcgagaatccagggctcgctctgctacaccgccgccgactac
gaggccgtcatcgacctgatgagccagggccactacgacacgacggggtgggtggacaag
atcacgctcgacggcgtcatcgacgatggattcgaggcgctgcatgcgggcaccaagatg
aaggtcctggtcgacccctccaccggagcagcgtcatga

DBGET integrated database retrieval system