KEGG   Rhodococcus sp. B7740: NY08_5138Help
Entry
NY08_5138         CDS       T03776                                 

Definition
(GenBank) secreted alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
rhb  Rhodococcus sp. B7740
Pathway
rhb00790  Folate biosynthesis
rhb01100  Metabolic pathways
rhb02020  Two-component system
Module
rhb_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rhb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NY08_5138
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NY08_5138
Enzymes [BR:rhb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     NY08_5138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-ProteinID: AJW43132
UniProt: A0A0D5AJ54
Position
5210493..5212091
Genome map
AA seq 532 aa AA seqDB search
MAVAVAGVATTLPATAHAQGSDRGFLHGVASGDPLPDAIVLWTRVTPTPDATPGSGVGPQ
VSVTWRIARSADMSDVVSSGTVATGPDADHTVKVDVDGLAADTTYFYDFRTSDAVSAVGT
THTAPRNDADIDAMRFGVVSCSNWESGYFGAYRHLAARGDLDAIVHLGDYIYEYETGGFP
GRDGVIRQHSPTHEIVTLADYRQRHGQYKSDPDLQAAHVGVPWICTWDDHESANDAYDTG
AQNHTPGTEGDWSTRKANSEQAYYEWMPVRAAGTATNRHLYRRLRFGNLLELSMLDLRTY
RLQQVLPFNGPEVDSPNRTITGAEQMQWLTDGIVSSPTQWKIVGNPVMITPTLIPPLDRD
AARAVTSLLGIPEGGLPYNADPWDGYTADRRKLLGAIVDAGVDNTVFITGDIHSAWACEV
PLDAARYATTEPAATELVVTSVSSANIDDLTRTPPHTLGRVAEEAFKALNHHVKFVDLDS
HGFGVFELTKTAARMDHWFLTAKEDPQTGVYWGAGFTVDSGTQRVRAAAPPA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtcgcggtggccggagtcgccacgacactgcctgcgaccgcacacgcacagggc
agcgaccgcggcttcctgcacggggtcgcatcgggagatccgttgcccgacgcgatcgtc
ctctggacccgcgtcactcccacgcccgacgccacccctggctccggcgtcggacctcag
gtatcggtgacgtggcggatcgcccgcagcgcggacatgagtgacgtggtctcctccgga
accgtcgcaaccggccccgacgccgaccacaccgtcaaggtcgacgtcgacggcctcgct
gccgacacgacgtacttctacgacttccggacgagcgacgcggtatcggccgtcgggacc
acgcacaccgctccgcgcaacgacgccgacatcgacgcgatgcgcttcggcgtcgtctcg
tgctcgaactgggagtcggggtacttcggtgcgtaccggcatctggccgccaggggagac
ctcgatgccatcgtccatctcggcgactacatctacgagtacgagacgggcgggttcccg
ggccgcgacggggtgatccggcagcattcgcccacccacgagatcgtcacgctcgccgat
taccgtcagcgccacggtcagtacaagtcggatcccgatctgcaggcggcgcatgtcggt
gtgccatggatctgcacgtgggacgaccacgaatccgccaacgatgcctacgacaccggc
gcgcagaatcacaccccgggcaccgagggcgattggtccactcgcaaggccaactccgag
caggcgtactacgagtggatgccggtacgcgccgcgggcaccgcgaccaaccgccatctc
taccgcaggctccggttcggcaacctgctggaactatcgatgctggatctgcgcacctac
cgtttgcagcaggtgttgccgttcaacgggcccgaggtcgattcgcccaaccggaccatc
accggtgcggagcagatgcagtggctcaccgacgggatcgtctcgtcgccgacgcagtgg
aagatcgtcggcaatccggtgatgatcacgcccaccctcatcccgccgctcgatcgagat
gcggccagggccgtcacctcgcttctcggaatcccggagggcggcctgccgtacaacgcc
gatccgtgggacgggtacaccgccgaccggcgcaagctgctcggtgccatcgtcgacgct
ggcgtcgacaacaccgtcttcatcaccggcgacatccattcggcgtgggcctgcgaggtg
ccgcttgatgcggcgcgctacgcaacgacggaacccgctgcgaccgaactcgtcgtcacc
tcggtgagctcggccaacatcgacgacctgacgcgtactccgccgcacacgctgggccgg
gtcgccgaggaagcattcaaggcactcaaccaccacgtgaagttcgtggacctcgacagc
cacggcttcggcgttttcgagctcaccaagactgcggctcggatggaccactggttcctc
accgccaaggaggatccgcagaccggcgtgtactggggagcgggcttcaccgtggactcg
ggcacccagcgcgtccgggcggcggcaccgcctgcctga

DBGET integrated database retrieval system