KEGG   Rhodovulum sp. P5: RGUI_1541Help
Entry
RGUI_1541         CDS       T04813                                 

Definition
(GenBank) Pyruvate dehydrogenase E1 component beta subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rhc  Rhodovulum sp. P5
Pathway
rhc00010  Glycolysis / Gluconeogenesis
rhc00020  Citrate cycle (TCA cycle)
rhc00620  Pyruvate metabolism
rhc01100  Metabolic pathways
rhc01110  Biosynthesis of secondary metabolites
rhc01120  Microbial metabolism in diverse environments
rhc01130  Biosynthesis of antibiotics
rhc01200  Carbon metabolism
Module
rhc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RGUI_1541
   00020 Citrate cycle (TCA cycle)
    RGUI_1541
   00620 Pyruvate metabolism
    RGUI_1541
Enzymes [BR:rhc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RGUI_1541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 QRPTase_N HlyD_3 PTS_EIIA_1 RnfC_N ATP-synt_ab_Xtn Peptidase_M23 DUF2457
Motif
Other DBs
NCBI-ProteinID: ARE39682
UniProt: A0A1V0PU63
Position
1429871..1430326
Genome map
AA seq 151 aa AA seqDB search
MATEILMPALSPTMEEGTLAKWLVKEGDTVSAGDILAEIETDKATMEFEAVDEGILGKIL
IEAGTDGVKVNTPIAVLVEDGEDADAAAAQSASPAPQATKTPPPRPRQNQRPPRPRPNRI
SPKAPNYAPAPCARRCGTPWPRRCAATTPSS
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaaatcctgatgcccgcgctctcccccacgatggaggaaggcacgctcgcc
aaatggcttgtgaaagagggcgataccgtctcggccggcgatatcctcgccgagatcgaa
accgacaaggccacgatggaattcgaggccgtggatgaaggcattctcggcaagatcctg
atcgaggccggcaccgatggcgtgaaggtcaacacccccatcgccgttctggtcgaggat
ggcgaggatgccgatgccgccgccgcgcaatcggccagccccgcgccgcaagccaccaaa
acgcccccgccgcggccccggcagaaccaaaggcccccgcgcccgcggccgaaccggatt
tccccgaaggcaccgaattacgctcctgcaccgtgcgcgaggcgctgcgggacgccatgg
ccgaggagatgcgccgcgacgacaccgtcttcctga

DBGET integrated database retrieval system