KEGG   Rhodovulum sp. P5: RGUI_2119Help
Entry
RGUI_2119         CDS       T04813                                 

Definition
(GenBank) Ketoglutarate semialdehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
rhc  Rhodovulum sp. P5
Pathway
rhc00040  Pentose and glucuronate interconversions
rhc00053  Ascorbate and aldarate metabolism
rhc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RGUI_2119
   00053 Ascorbate and aldarate metabolism
    RGUI_2119
Enzymes [BR:rhc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     RGUI_2119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ARE40260
UniProt: A0A1V0PVW9
Position
2013856..2015382
Genome map
AA seq 508 aa AA seqDB search
MLDDGKFTPHGRHLIAGDWVAGAETFTSAPAHGPSHDFSVGTPDLVDRAAKAAEEAFWSY
GSSSRDDRAAFLHAIADEIEARAEATTEIGTQETGLPEARLQGERGRTTGQLRLFADHIG
KGDYLDRRHDIALPDRAPLPRPDLKMVQRPIGPVAVFGASNFPLAFSTAGGDTASALAAG
CPVVVKGHSAHPGTGEIVAEAIHAAIGKCGVHPGVFSLIQGGKRDVGQALVQHPLIRAVG
FTGSLAGGRALFDLCAARPDPIPFFGELGSVNPMFLLPAALAARGADIASGWAGSLTMGA
GQFCTNPGIAVVIDSPDADAFIEATTAALEPMGAQTMLTDGIATAYRAGRDRVAGTAGVQ
EVLTSVCDLRNATPYLFATTGAEWLANEVLGEEVFGPLGLIVRVADMDEMLKVAHSLQGQ
LTCTLHMDDADTAVAQTLMPILERKAGRVLANGFPTGVEVCDAMVHGGPYPASTNFGHTS
VGTLAIRRFLRPVCYQNIPDALMPGDWK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctggatgacggaaaattcacgccccacgggcgtcacctgatcgcgggcgactgggtt
gccggggcggagacgttcacctccgcccccgcccatgggccgtcgcacgacttcagtgtc
ggcacgcccgacttggtggaccgtgcggccaaagcggcggaagaggcgttctggtcctac
gggtcgtccagccgggacgaccgcgccgcgttcctgcacgccatcgcggacgagatcgag
gcgcgggccgaggcgaccaccgaaatcggcacccaggaaaccggcctgccggaggcgcgg
ttgcagggcgaacggggccgaaccaccggacaattgcggctgttcgcggaccatatcggc
aagggcgactacctcgaccggcgccacgacatcgcgctgcccgaccgcgcgcccctgccc
cggcccgacctgaaaatggtgcagcgccccatcggtccggttgcggtcttcggcgcctcc
aatttcccgctggccttttccaccgccgggggcgacacggcctcggccctggccgccggc
tgcccggtggtggtcaagggccactccgcccatcccggcaccggagagatcgtggccgag
gcgatccatgcggccatcgggaaatgcggcgtgcatcccggcgtcttctccctgatccag
gggggcaagcgcgatgtgggtcaggcgctggtacagcatccgctgatccgggcggtcggc
tttaccggatcgctggccgggggccgggcgctgtttgatctgtgcgccgcgcgccccgac
ccgatcccgttcttcggggaactcggctcggtcaacccgatgttcctgttgcccgcggcg
ctggccgcccggggagcggacatcgcgtccggctgggcggggtcactgaccatgggagcg
ggacagttctgcacaaatcccggtatcgcggttgtcatcgacagccccgacgccgacgcc
tttatcgaggccacgaccgccgcgctggaaccgatgggcgcacaaaccatgctgaccgac
ggcatcgcaaccgcctatcgggcgggccgcgaccgggtggcaggaacagcgggcgtgcag
gaggtgctgaccagcgtctgcgatctgaggaacgccacgccctacctgtttgccacgacc
ggcgcggaatggctcgccaacgaggtcttgggggaggaggtctttggcccccttggcctg
atcgtgcgggtggccgacatggacgagatgctgaaggtggcgcactcgctgcagggacaa
ttgacctgcacgctgcatatggacgacgccgataccgcggtcgctcagaccctgatgccg
atccttgaacgcaaggcaggccgggtgctggccaacggcttccccacgggcgtggaggtt
tgtgacgcgatggtgcatggcggcccctaccccgcctccaccaatttcggccacacctcc
gtgggcaccctcgccatccgccgcttcctgcgaccggtctgctatcagaacatccccgac
gcactgatgccgggtgactggaaatga

DBGET integrated database retrieval system