KEGG   Rhodovulum sp. P5: RGUI_2375Help
Entry
RGUI_2375         CDS       T04813                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhc  Rhodovulum sp. P5
Pathway
rhc00071  Fatty acid degradation
rhc00072  Synthesis and degradation of ketone bodies
rhc00280  Valine, leucine and isoleucine degradation
rhc00310  Lysine degradation
rhc00362  Benzoate degradation
rhc00380  Tryptophan metabolism
rhc00620  Pyruvate metabolism
rhc00630  Glyoxylate and dicarboxylate metabolism
rhc00640  Propanoate metabolism
rhc00650  Butanoate metabolism
rhc00900  Terpenoid backbone biosynthesis
rhc01100  Metabolic pathways
rhc01110  Biosynthesis of secondary metabolites
rhc01120  Microbial metabolism in diverse environments
rhc01130  Biosynthesis of antibiotics
rhc01200  Carbon metabolism
rhc01212  Fatty acid metabolism
rhc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RGUI_2375
   00630 Glyoxylate and dicarboxylate metabolism
    RGUI_2375
   00640 Propanoate metabolism
    RGUI_2375
   00650 Butanoate metabolism
    RGUI_2375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    RGUI_2375
   00072 Synthesis and degradation of ketone bodies
    RGUI_2375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    RGUI_2375
   00310 Lysine degradation
    RGUI_2375
   00380 Tryptophan metabolism
    RGUI_2375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RGUI_2375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    RGUI_2375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    RGUI_2375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhc04147]
    RGUI_2375
Enzymes [BR:rhc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     RGUI_2375
Exosome [BR:rhc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RGUI_2375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ARE40516
UniProt: A0A1V0PWL5
Position
2264027..2265199
Genome map
AA seq 390 aa AA seqDB search
MDKVVICGAARTPMGGFQGVFATVPAPTLGGAAIRAAMDGAGVATVDELLMGCVLPAGQG
QAPARQAGFSAGLGEDVPATTVNKMCGSGMKTAMMAHDQLALGAAGVICAGGMESMTNAP
YLLPNMRGGARIGHGQALDHMFLDGLEDAYDKGRLMGTFAEDCAETFQFTREAQDDYALG
SLSNALAAQSSGAFEGEIAPVTVTTRKGDTVVAEDEQPGQARPEKIPHLKPAFRRDGTVT
PANSSSISDGAAAVILARGEVAEARGLPVRARILGHASHAQAPGWFTTAPVPAAQKLLAR
IGWSKDDVDLWEVNEAFAVVPMAFMHEMGLPRDRVNVNGGACALGHPIGASGTRIIVTLL
NALEKRGLKRGVAAICIGGGEGTAIAIERP
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggtcgtgatctgtggcgccgcgcggaccccgatgggaggatttcagggcgtt
ttcgcgaccgtgccggcgccaaccttgggcggcgcggccatccgcgccgcgatggacggg
gccggggtcgcgaccgtggacgagcttttgatgggctgcgtgctgcccgcggggcagggg
caggccccggcgcgacaggccggtttcagcgccgggctgggggaagacgtacccgccacg
accgtcaacaagatgtgcggatcgggcatgaagacggcgatgatggcccatgaccagttg
gccttgggcgcggcgggcgtgatctgcgccggggggatggagagcatgacgaatgcacca
tacctcttgcccaacatgcgtggcggcgcgcggatcggccatggtcaggcactggaccac
atgttcctcgacgggctggaggacgcgtatgacaagggccgcctgatgggcacctttgcc
gaggattgcgccgagacattccagtttacgcgagaggcgcaggacgactacgcactggga
tccctctcgaacgcgcttgccgcgcaaagctccggcgcgttcgagggtgagatcgccccg
gtcaccgtgaccacgcgcaagggcgacaccgtggtggcagaggacgaacagcccgggcag
gcgcgacccgagaagatcccccatctcaagcccgcctttcgcagggatggcacggtgacg
ccggccaattcgtcctcgatctcagacggggcggcggcggtgatccttgcccgcggcgag
gtggccgaggcgcgcggcctgcccgtgcgcgcccgcatccttggccatgccagccatgcg
caggcaccgggatggttcaccaccgcgccggtgccggcggcccaaaagctgctggccagg
atcggctggtccaaggacgacgtcgatctgtgggaggtgaacgaggctttcgccgtggtc
cccatggccttcatgcatgaaatgggactgccgcgcgaccgggtgaacgtcaacggcggc
gcctgcgcactgggtcacccgatcggggcctcgggcacgcggatcatcgtcacgctgctg
aacgcgctggaaaagcggggcctgaaacggggcgttgcggcgatctgtatcggcggcggc
gaaggcaccgcaatcgccatcgagcggccatga

DBGET integrated database retrieval system