KEGG   Rhodanobacter denitrificans: R2APBS1_0035Help
Entry
R2APBS1_0035      CDS       T02495                                 

Definition
(GenBank) Phenylalanine 4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
rhd  Rhodanobacter denitrificans
Pathway
rhd00360  Phenylalanine metabolism
rhd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rhd00790  Folate biosynthesis
rhd01100  Metabolic pathways
rhd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    R2APBS1_0035
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    R2APBS1_0035
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    R2APBS1_0035
Enzymes [BR:rhd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     R2APBS1_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AGG87223
UniProt: M4NCR8
Position
complement(39289..40176)
Genome map
AA seq 295 aa AA seqDB search
MDTPRKVEHQQTDRGYVPVYATGVVEQPWASYSQSDHEVWDTLFKRQRELLPGRACREFL
AGVERFGLGNGGIPKFEDVTRVLRQATGWELVAVEGLLPDEVFFDHLAHRRFPVSWWIRK
PEQLDYLSEPDLFHDLFGHVPLLLNPVFADYMQAYGRGGMKAFAIGPEALMNLTRLYWYT
VEFGLIHTAEGMRIYGAGIVSSKGESIYCLDSPSPNRIGFGLERVMSTRYRIDTYQQTYF
VIDSFEQLFEATRPDFTPIYAKLRERPAHAAGDVLDGDRVFTRGDRVGWAANADT
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggacacgccccgcaaagtcgaacaccagcagaccgaccgcggctacgtgccggtgtac
gccaccggcgtggtcgagcagccgtgggccagctacagccagagtgaccacgaggtgtgg
gacaccttgttcaagcgccagcgcgaactgctgcccgggcgcgcctgccgggagttcctc
gccggggtggagcgcttcggcctgggcaacggtggcatcccgaagttcgaggacgtcacc
cgggtactgcgccaggccactggctgggagctggtggcggtggaaggcctgctgccggac
gaggtgttcttcgaccacctggcgcatcgccgcttcccggtcagctggtggatcaggaaa
cccgagcagctcgactacctgagcgaaccggacctgttccacgacctgttcggccatgtg
ccgctcttgctcaacccggtgttcgccgactacatgcaggcctacggccgcggcggcatg
aaggcgttcgcgatcggccccgaggcgctgatgaacctgacccggctgtactggtacaca
gtggagttcggcctgatccacaccgccgaaggcatgcgcatctacggcgccggcatcgtc
agctccaagggcgagtcgatctactgcctggattcgccgtcaccgaaccgcatcggcttc
ggcctggaacgcgtgatgagcacgcgctaccgcatcgacacctaccagcagacctacttc
gtgatcgacagcttcgagcagctgttcgaggcgacccggccggacttcacgccgatctac
gccaagctgcgcgagcggccggcgcacgctgccggcgacgtgctggacggcgaccgcgtg
ttcacccgcggcgaccgcgtgggctgggcggccaacgcggatacctga

DBGET integrated database retrieval system