KEGG   Rhodanobacter denitrificans: R2APBS1_2547Help
Entry
R2APBS1_2547      CDS       T02495                                 

Definition
(GenBank) arginase family hydrolase, arginase/agmainase/formiminoglutamate hydrolase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
rhd  Rhodanobacter denitrificans
Pathway
rhd00220  Arginine biosynthesis
rhd00330  Arginine and proline metabolism
rhd01100  Metabolic pathways
rhd01110  Biosynthesis of secondary metabolites
rhd01130  Biosynthesis of antibiotics
rhd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rhd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    R2APBS1_2547
   00330 Arginine and proline metabolism
    R2APBS1_2547
Enzymes [BR:rhd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     R2APBS1_2547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AGG89633
UniProt: M4NIY1
Position
complement(2702518..2703354)
Genome map
AA seq 278 aa AA seqDB search
MQAVDHPFDLVLSYPQWQGSGRPEHLRRGAQAAADVCRNYGPLERVPEAGGGEASGGVRR
WTAIAEQFRSAQAILDARQPRRILTAGGDCACDIAVIDYLRRRYPDLTVIWVDAHLDANT
VNTTPSGNFHGMPVAAILGSAPVELQALLSTPLLPTQFRYFSAHVGDEGDWAFQRARDLR
WLEPGQRIAEQVGSGPIHIHFDLDALDPAEFPHVAYPDGKLPFDAGLALVRSVAADLVGL
TITEFAPSDERAARHGSGFVERLCKAARPLQKGVRDNF
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagctgtcgatcatccattcgatctggtgctgtcctatccgcaatggcaaggctcg
ggacgcccggaacacctgcgtcggggcgcgcaggccgcggccgatgtctgccgcaactac
gggccactcgagcgtgtcccggaggctggcgggggcgaggccagcggcggtgtccggcgc
tggacagcgatcgccgagcaattccgttcggctcaggcgatccttgatgcgaggcagccc
aggcgcatcctgaccgccggcggggattgcgcctgcgatattgcggtcatcgactacctg
cgtcgacgatatccggacctgaccgtgatctgggtggacgcgcatctcgacgcgaacacg
gtgaacacgacgcccagcggcaatttccacggcatgccggtggccgcgatcctgggttcc
gctccggtcgagctgcaggcgttgctttcgacaccgctgttaccgacacaattccgttat
ttctcggcacatgttggcgatgagggcgattgggcgttccagcgagctcgtgacctgagg
tggctggaacccgggcaacgcatcgccgaacaggtcggttcggggcccatccacattcat
ttcgatctggacgcgctcgatcctgctgaattcccgcacgttgcctatcccgatggcaag
ctgccgttcgacgccgggcttgccttggtgcgcagcgtggccgccgatctggtcggtctg
acgatcaccgagtttgcaccttcggacgaacgcgctgcgcggcacggcagtggcttcgtc
gaacggctatgcaaggccgcaaggccgctgcaaaaaggtgtcagggacaatttctga

DBGET integrated database retrieval system