KEGG   Rhodanobacter denitrificans: R2APBS1_2563Help
Entry
R2APBS1_2563      CDS       T02495                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhd  Rhodanobacter denitrificans
Pathway
rhd00071  Fatty acid degradation
rhd00072  Synthesis and degradation of ketone bodies
rhd00280  Valine, leucine and isoleucine degradation
rhd00310  Lysine degradation
rhd00362  Benzoate degradation
rhd00380  Tryptophan metabolism
rhd00620  Pyruvate metabolism
rhd00630  Glyoxylate and dicarboxylate metabolism
rhd00640  Propanoate metabolism
rhd00650  Butanoate metabolism
rhd00900  Terpenoid backbone biosynthesis
rhd01100  Metabolic pathways
rhd01110  Biosynthesis of secondary metabolites
rhd01120  Microbial metabolism in diverse environments
rhd01130  Biosynthesis of antibiotics
rhd01200  Carbon metabolism
rhd01212  Fatty acid metabolism
rhd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R2APBS1_2563
   00630 Glyoxylate and dicarboxylate metabolism
    R2APBS1_2563
   00640 Propanoate metabolism
    R2APBS1_2563
   00650 Butanoate metabolism
    R2APBS1_2563
  09103 Lipid metabolism
   00071 Fatty acid degradation
    R2APBS1_2563
   00072 Synthesis and degradation of ketone bodies
    R2APBS1_2563
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    R2APBS1_2563
   00310 Lysine degradation
    R2APBS1_2563
   00380 Tryptophan metabolism
    R2APBS1_2563
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    R2APBS1_2563
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    R2APBS1_2563
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    R2APBS1_2563
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhd04147]
    R2APBS1_2563
Enzymes [BR:rhd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     R2APBS1_2563
Exosome [BR:rhd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   R2APBS1_2563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: AGG89649
UniProt: M4NFL6
Position
2722323..2723507
Genome map
AA seq 394 aa AA seqDB search
MSDVSVVIVGAKRTAIGSFLGQFTGVPTPKLGATAIRAALEQSGVAPADVGEVIMGCVLP
ANLGQAPARQASLGADLPAGTGCTTINKVCGSGMKAIMLGHDLIKAGSAAIVVAGGMESM
TNAPHMVQARTGIRYGDGQLVDHMAWDGLTNPYDGKAMGVFGELCADKYHFTREAQDAFA
IESVNRAKAAQQNGAFAGEIVPVTVSGRKGDVVVDTDEQPGRSDVAKIPSLKPAFRKENG
TITAASSSSISDGAAAVVLLSADDANKRGLKPLARIVAHATHSQEPEWFTTAPVGAIQKV
LDKAGWKVDEVDLFEINEAFAVVAMTPMKELGIQHAKLNVNGGACALGHPIGASGARLVV
TLLNALKVRGLKRGVASLCIGGGEATAIAVECID
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgtcagcgtcgtcatcgtcggtgccaagcgcaccgccatcggctccttcctc
ggccagttcaccggcgtgcccaccccgaagctcggcgccaccgcgattcgcgccgcgctg
gagcagtcgggcgttgccccggccgacgtcggcgaggtgatcatggggtgcgtgctgccg
gccaacctcggccaggcgccggcacgccaggcctcgctgggcgccgatctgccggccggc
accggctgcaccaccatcaacaaggtgtgcggctcaggcatgaaggcgatcatgctgggc
cacgacctgatcaaggccggctcggcggccatcgtggtggccggcggcatggagtcgatg
accaatgcgccgcacatggtgcaggcgcgcaccggcatccgctacggcgacggccagctg
gtcgaccacatggcctgggacggcctgaccaacccgtacgacggcaaggcgatgggcgtg
ttcggcgagctgtgcgccgacaagtaccacttcacccgcgaagcgcaggacgcgttcgcg
atcgagtcggtcaaccgggccaaggccgcgcagcagaatggcgcgttcgccggcgagatc
gtgccggtgacggtgagcggccgcaagggcgacgtggtggtcgacaccgacgagcagccc
gggcgctccgacgtggccaagattccctcgctgaagcccgccttccgcaaggagaacggc
acgatcactgccgccagctcctccagcatctccgacggcgcggccgccgtggtgctgctg
tcggccgacgacgcgaacaagcgcggcctgaaaccgctggcgcgcatcgtggcgcacgcc
acccactcgcaggaaccggagtggttcaccaccgcgccggtcggtgcgatccagaaggta
ctggacaaggccggctggaaggtcgacgaggtcgacctgttcgaaatcaacgaggcgttc
gcggtggtggcgatgaccccgatgaaggaactcggcatccagcacgccaagctcaacgtc
aacggcggcgcctgcgccctgggccatccgatcggcgccagcggcgcgcgcctggtggtg
accctgctgaacgcgctgaaggtgcgcgggctcaagcgcggggtcgcctccctgtgcatc
ggcggcggcgaggcgaccgcgattgcggtggaatgcatcgactga

DBGET integrated database retrieval system