KEGG   Rickettsia heilongjiangensis: Rh054_00825
Entry
Rh054_00825       CDS       T01587                                 

Definition
(GenBank) type IV secretion system protein VirB3
  KO
K03198  type IV secretion system protein VirB3
Organism
rhe  Rickettsia heilongjiangensis
Pathway
rhe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:rhe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Rh054_00825
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rhe02044]
    Rh054_00825
Secretion system [BR:rhe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Rh054_00825
SSDB
Motif
Pfam: VirB3
Other DBs
NCBI-ProteinID: AEK74180
Position
136896..137183
AA seq 95 aa
MAGALASDLLFVGLTRPPMIFGVSIKFAALNMIMTMIVFIWNNSIMILFIAAALHLVAYI
ICFKEPRFIELYLNKMSRTSQCPNKFYYGANSYNI
NT seq 288 nt   +upstreamnt  +downstreamnt
atggcaggagcattagcatccgatcttttatttgtagggttaactagaccgccgatgata
tttggagtaagtattaagtttgctgcattaaatatgataatgacgatgatagtatttatt
tggaataacagcattatgattttattcattgcagctgctttgcatttggtagcttatatt
atatgttttaaagaaccgagattcatagagctatatttaaataaaatgtcaagaactagc
caatgtcctaataaattttactacggagcaaattcgtataatatttga

DBGET integrated database retrieval system