KEGG   Rickettsia heilongjiangensis: Rh054_06225Help
Entry
Rh054_06225       CDS       T01587                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhe  Rickettsia heilongjiangensis
Pathway
rhe00071  Fatty acid degradation
rhe00072  Synthesis and degradation of ketone bodies
rhe00280  Valine, leucine and isoleucine degradation
rhe00310  Lysine degradation
rhe00362  Benzoate degradation
rhe00380  Tryptophan metabolism
rhe00620  Pyruvate metabolism
rhe00630  Glyoxylate and dicarboxylate metabolism
rhe00640  Propanoate metabolism
rhe00650  Butanoate metabolism
rhe00900  Terpenoid backbone biosynthesis
rhe01100  Metabolic pathways
rhe01110  Biosynthesis of secondary metabolites
rhe01120  Microbial metabolism in diverse environments
rhe01130  Biosynthesis of antibiotics
rhe01200  Carbon metabolism
rhe01212  Fatty acid metabolism
rhe02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Rh054_06225
   00630 Glyoxylate and dicarboxylate metabolism
    Rh054_06225
   00640 Propanoate metabolism
    Rh054_06225
   00650 Butanoate metabolism
    Rh054_06225
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rh054_06225
   00072 Synthesis and degradation of ketone bodies
    Rh054_06225
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rh054_06225
   00310 Lysine degradation
    Rh054_06225
   00380 Tryptophan metabolism
    Rh054_06225
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rh054_06225
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rh054_06225
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Rh054_06225
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhe04147]
    Rh054_06225
Enzymes [BR:rhe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Rh054_06225
Exosome [BR:rhe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rh054_06225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEK75110
UniProt: G0GZF2
Position
complement(1060668..1061846)
Genome map
AA seq 392 aa AA seqDB search
MTKPVYITYAKRTAFGSFIGSLSTTAAPMLAAHLIKDILQNSKIDPALVGEVILGQVITG
GSGQNPARQTLIYAGIPKEVPGYTINKVCGSGLKSVALAANSIMTGDNEIVIAGGQENMS
LGMHGSYIRAGAKFGDIKMVDLMQYDGLTDVFSGVFMGITAENISKQFNISRQQQDEFAL
SSHKKAAKAQLAGVFKDEILPIEVTIKKTTSLFDHDETVRPDTSLEILSKLRPAFDKNGV
VTAGNASAINDGAACLMVVSEEALKKHNLTPLARIVSYASAGVDPSIMGTAPVPASKKAL
SKAGWSVNDLEVIEVNEAFAAQSIYVNREMKWDMEKVNVNGGAIAIGHPIGASGGRVLIT
LIHGLRRAKAKKGLVTLCIGGGMGMAMCVEAV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaccggtttatataacttatgcgaaaaggactgctttcggctcgtttataggt
agccttagtacaacagctgcacctatgcttgctgctcatttaataaaggatatactgcaa
aacagcaaaatcgatccagctttagtaggtgaggtaatccttggacaggtaataaccggc
ggtagcgggcagaatccggcgaggcaaactctgatttatgcgggaataccgaaagaagtg
ccgggctatacgattaataaagtatgtggctcaggtcttaaaagcgtagcacttgcagca
aattcaattatgacgggtgataatgaaatagttatagcaggtgggcaggagaatatgtcg
ctcggtatgcacggtagctatatcagagcaggagctaaattcggcgatattaaaatggtt
gatctaatgcagtatgacggattaaccgatgtattttcaggagtatttatgggtattaca
gccgaaaatatctcgaaacagtttaatattagcagacaacagcaggacgagtttgcctta
agctctcacaagaaagcagctaaagcacagctagcaggagtttttaaagatgaaatctta
cctatcgaagtaacgattaaaaaaactactagtttgtttgatcatgatgaaacagtaaga
cctgataccagccttgaaattctgagtaaattacgtcctgcttttgataaaaacggtgta
gttacagcgggtaatgcttccgctattaatgacggtgcggcatgtcttatggtagtttcc
gaagaagctttgaaaaagcataatttaacgccgctagctcgtattgtttcttatgcttca
gccggtgttgatccaagtattatgggtactgcccctgttcctgcatccaaaaaagcttta
agtaaagcaggttggagcgttaatgatttggaagttatcgaggttaatgaggcgtttgcc
gctcaaagtatttatgtaaaccgtgaaatgaaatgggatatggagaaggttaatgttaac
ggtggagcaatagcaatcggtcatccgatcggggcaagtggcggacgtgtactgattact
ctgatacacggcttacgaagagctaaagctaaaaaaggcttagttactttatgtatcggt
ggcggtatgggtatggctatgtgtgttgaagcggtttaa

DBGET integrated database retrieval system