KEGG   Rhodoferax sp. Gr-4: EXZ61_16860Help
Entry
EXZ61_16860       CDS       T06176                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
rhg  Rhodoferax sp. Gr-4
Pathway
rhg00860  Porphyrin and chlorophyll metabolism
rhg01100  Metabolic pathways
rhg01110  Biosynthesis of secondary metabolites
rhg01120  Microbial metabolism in diverse environments
Module
rhg_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:rhg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EXZ61_16860 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:rhg01007]
    EXZ61_16860 (hemL)
Enzymes [BR:rhg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     EXZ61_16860 (hemL)
Amino acid related enzymes [BR:rhg01007]
 Aminotransferase (transaminase)
  Class III
   EXZ61_16860 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: QDL55704
UniProt: A0A515ESR7
Position
3635308..3636612
Genome map
AA seq 434 aa AA seqDB search
MQPVTDRNLQLFERAQNVIPGGVNSPVRAFKAVGGTPRFVSRAQGAYFWDANNKRYIDYI
GSWGPMILGHGHPAVVQAVQEAVLEGFSYGAPTEREVELAEAILQAVPSMDMVRLVSSGT
EASMSAIRVARGATNRPKFIKFEGCYHGHSDALLVKAGSGLATFGNPTSSGVPPEVVQHT
LVLEYNNVAQLEEAFALHGKELACLIIEPIAGNMNFVRASVPFMKRCRELCSEYGALLVF
DEVMTGLRVALGSAQSVYARSIPGFEPDMTVLGKVIGGGMPLAAFGGKRHLMQQLAPLGT
VYQAGTLSGNPVATACGLATLREISKPGFYEALGQKSQALISGLQGAADAAGVPFCGDSE
GGMFGFFLFDSLPQNYARVMQTDNQRFNTLFHGMLDRGVYFAPALYEAGFMSAAHTEEDI
AATVAAASEVFKLL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgcaacccgtcactgaccgcaacctccaactctttgaacgcgcacagaacgtcattccc
ggtggcgtgaattcccccgtgcgggcctttaaggccgtgggcggcacgccccgttttgtc
tcccgtgcgcaaggcgcctacttttgggatgccaacaacaagcgttatatcgactacata
ggctcgtggggccccatgattttgggacacgggcacccggccgtagtgcaggccgtgcaa
gaagcagtgctcgaaggcttctcgtatggtgcccccaccgagcgggaagtagaactggcc
gaagccattttgcaagcagtgcccagcatggacatggtgcgcttggtgagctctggcacc
gaagcctctatgagcgccattcgagtggcccgaggcgctaccaaccgccccaagttcatc
aagtttgagggctgctaccacggccactcggatgcactcttggtcaaggccggctctggc
ctggctacgtttggcaaccccaccagctctggcgtcccccctgaagtggtgcagcacacc
ttggtgctggaatacaacaatgtggcgcaactcgaagaagcctttgccctgcatggcaaa
gagttggcctgcctgatcatcgagcccattgcgggcaatatgaactttgtgcgcgcctcc
gtgccctttatgaagcgctgccgcgaactgtgctctgagtacggtgcactcttggtgttt
gacgaggtcatgaccggcctgcgcgtggccttgggcagcgcgcaaagcgtgtacgcgcgc
tccatacccggctttgagccagacatgaccgtattgggcaaagtgattggtggcggcatg
cccttggcggcttttggcggcaagcgccacctcatgcagcaactggctcccttgggcacg
gtgtaccaagccggcaccttgtctggcaaccccgtagccaccgcctgcggcttggccact
ctgcgcgaaatcagcaaaccgggcttttatgaagcactggggcaaaagagccaagccttg
atcagcggcctgcaaggcgctgccgatgccgcgggtgtgcccttctgtggcgacagcgaa
ggtggcatgtttggcttcttcttgtttgacagcctgccgcaaaactacgcgcgcgtcatg
cagacggacaaccaacgtttcaacaccctgttccacggcatgctagatcgcggcgtgtac
tttgccccggcgctctacgaggcgggctttatgagcgcagcccacaccgaagaagacatc
gccgcgaccgtggcagccgctagcgaagtcttcaagttgctttaa

DBGET integrated database retrieval system