KEGG   Rheinheimera sp. D18: E0Z06_14935Help
Entry
E0Z06_14935       CDS       T05923                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
rhh  Rheinheimera sp. D18
Pathway
rhh00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rhh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    E0Z06_14935
Enzymes [BR:rhh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     E0Z06_14935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase 3HCDH_N THF_DHG_CYH_C 2-Hacid_dh_C 3Beta_HSD AdoHcyase_NAD DUF853
Motif
Other DBs
NCBI-ProteinID: QBL10726
Position
3182802..3183569
Genome map
AA seq 255 aa AA seqDB search
MYNSTDFTLHGQVAVVTGAGAGIGRAIAETFAAAGAAVMVSDLKQETANAVAEQIIANGG
KAAAIACDITKEDDLSRLINETVSQLGKLTILVSNAGGGGPKPFDMPMADFKRAFDLNVF
SLFRLAQLAAPEMEKAGGGSILAITSMAGENKNEHMASYAASKAATNHLIRNIAFDLGPK
NIRVNGIAPGATRTTALQSVLTPEIEQNMLKKTPIHRLGEPQDMANPALFLCSPAASWIS
GQILTVSGGGVQELE
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtacaactcaacagactttacactacatggacaggttgccgtagttactggcgcaggt
gcgggtattggtcgcgccattgctgaaacgtttgctgcagcgggcgccgcggtaatggtt
agcgatcttaaacaagaaacagctaatgctgttgcagagcagattatcgctaacggcggt
aaagccgccgccattgcttgcgatattacgaaagaagatgacttatctcgtttaattaat
gaaacagttagccaactaggtaagcttactattctggttagcaatgcaggtggcggcggg
cctaagccatttgatatgccaatggctgactttaagcgtgcatttgatttaaatgtgttt
tctttgtttcgcttagcgcaacttgccgcaccagaaatggaaaaagcaggcggtggctca
atcttggccattacctctatggcgggtgaaaataaaaatgaacatatggcgtcgtacgcc
gcatctaaggcggcaacaaatcaccttattcgcaatattgcgtttgatcttggcccgaaa
aatattcgcgttaatggcattgccccaggcgcaacccgcaccaccgcgttgcaatctgta
cttacgccagaaattgaacaaaatatgctgaagaaaactccgattcaccgactcggcgaa
ccgcaagatatggccaacccggcattatttctctgctcgcctgccgccagctggatcagt
ggtcaaattcttaccgtatcaggtggtggtgtgcaagaacttgagtaa

DBGET integrated database retrieval system