KEGG   Sinorhizobium fredii NGR234: NGR_a00690
Entry
NGR_a00690        CDS       T00888                                 

Symbol
rhcC1
Name
(GenBank) outermembrane protein RhcC1; component of type III secretion apparatus
Organism
rhi  Sinorhizobium fredii NGR234
SSDB
Motif
Pfam: Secretin_N Ferric_reduct COA2
Other DBs
NCBI-ProteinID: AAB91943
UniProt: P55712
Position
pNGR234a:84372..85076
AA seq 234 aa
MPTTPIPFTPLHMFRRLLCVGLFLFAGIHTTLGATLPLPSTSYKYTVLDQDLSAALQEFG
NNLKISVNISAEVKGRIRGRIPELSPREFLDRLTDLYDLQWYYDGVVLYVSAAKEAQTRM
LVLSSVHFSAFKLALDKLDISDERYPVRPAPGNGLVLVSGPPRFMALIEQTLNGLLAVAQ
AQPRATDTPARESVMVLFRGSSTTVVRGGRPEVFYTSEMLPENDDGGKAELSKK
NT seq 705 nt   +upstreamnt  +downstreamnt
atgccgacaacgccgatcccattcacaccgcttcatatgtttaggagactgctctgtgtc
gggctttttctatttgccggaatccacacaactctcggggccaccctgccactcccctcg
acctcctataagtatacggttctagatcaggatctctctgccgcgttgcaggagttcggc
aacaacctgaaaatcagtgttaacatcagcgcagaggtgaaggggcggattcgcgggcgt
ataccggagttgtcaccgcgcgagttcctcgaccgattgaccgatctctacgatctccaa
tggtattatgacggggttgtgctctatgtgtctgctgcaaaagaagcacaaactcggatg
cttgtgttgagttcagttcactttagtgctttcaagctcgccctcgataagcttgacatc
tctgatgagcgctatccggtgagacccgcgccgggaaatggcctggtcttagtgtccggc
ccgccgcgcttcatggcgctcatcgagcagacgttgaacggtctactggcagtggcgcag
gcgcagcctcgcgcaaccgatacgcccgccagggaatctgtgatggtactgtttcggggc
tcctccaccacggtcgtccgcggcgggagaccggaagtcttttatacttctgagatgctg
ccagagaacgacgatggcgggaaggctgagctgagcaagaaatga

DBGET integrated database retrieval system