KEGG   Sinorhizobium fredii NGR234: NGR_a00720Help
Entry
NGR_a00720        CDS       T00888                                 

Definition
(RefSeq) hypothetical protein
  KO
K01586  diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00300  Lysine biosynthesis
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01230  Biosynthesis of amino acids
Module
rhi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NGR_a00720
Enzymes [BR:rhi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     NGR_a00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Orn_Arg_deC_N Ala_racemase_N
Motif
Other DBs
NCBI-GeneID: 962536
NCBI-ProteinID: NP_444153
UniProt: P55709
Position
pNGR234a:87761..89134
Genome map
AA seq 457 aa AA seqDB search
MTLHCQKIGHGLPPILRSATADLLTKYGPLLFDWAARHGSPLNLVWPDALRENLAALKGV
LTERRLEHAIYYGAKANKSPGLMQAALSAGAGLDVSSLYELRDARRLGADGARLVATGPA
KTSAFHQELINCNALISVDSPEELEDLIHGLPADAGQQSILLRLRPRDQSKSRFGMPPDA
VVHCLARLAGEGRVRFDGLHFHLSGYRRETRVAALREAADLIAEARRMGFFPGMIDIGGG
LPIQYVDRARYKAHLAAQAPEDYRTGKIPDSFYPYGSTLSAADWLHRLLEAEMNQGRSVA
GYLAREGLTLAMEPGRALADQAAITVFRISRVKALGPDSHVIFVEGSSFSACETWFASEF
LIDPILVPATKATVQLPPVRAYLAGHSCLDEDVISNRWLTFPTAPRAGDLLVYANTGGYQ
MDLLENEFHRHPMPARFCVIEDAEGRPNLVPDTIGEV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcattgccagaagatcggccatgggctgccaccgattctgcgatcggcgact
gcggaccttctcaccaaatacggtcctcttcttttcgattgggccgcccgccacggctcc
ccgctcaatctggtctggccggatgcgttgcgggagaatcttgccgccttgaagggcgta
ctgacggagcgccgcctcgagcatgcgatctattacggggcgaaggccaacaaatcgccc
gggctcatgcaggcagcgctcagcgcaggcgccgggctcgacgtctccagcctctacgag
cttcgcgacgcaaggcggcttggggccgatggtgccaggctcgtggcgacgggaccggcg
aagacgagcgcatttcatcaagagctgatcaattgcaacgcgctgatatcggtggactcg
ccggaagaactggaggatctcatccacggtctgccggcagatgctggccaacagtccatc
ctcttgcgtttgcggccgagggaccaaagcaagagccgcttcggcatgccgcccgacgcg
gtcgttcattgcctcgctcggcttgccggtgaaggcagggtgcgtttcgacgggctgcat
ttccacctcagcggctatcgccgggagacccgtgtggcagcgctcagagaggccgccgac
ctcattgccgaagccaggcggatgggattttttccgggcatgatcgatattggcggtggc
ctgcctatccaatatgtcgaccgagccaggtacaaagcgcatctcgcggcgcaggcgccc
gaggactaccgcaccgggaaaataccggactctttctatccctatggcagcactctttca
gcagccgactggctgcaccggctcttggaggcggagatgaaccagggccgaagcgtagcc
ggctacctggcgcgtgagggtctcacgctggcgatggagcccggccgcgcgctggccgac
caggcggcgatcactgtctttcgaatctcgcgggtgaaggcgctcggtccggattcgcac
gtcatctttgtcgaaggtagcagcttcagcgcctgcgaaacttggttcgcctccgaattc
ctgatcgaccctattctcgtgcctgccaccaaggcgaccgttcaattgccgccggtccgc
gcctatctggccggccatagctgcctcgacgaggacgtcatcagcaaccggtggctgacg
ttcccgaccgcgccgcgcgctggcgacctgctcgtatacgccaacaccggcggctaccag
atggacctcctcgaaaacgagttccatcgccatcccatgcccgctcgcttctgcgtcatc
gaagacgccgaagggcggcccaatctcgttcccgacacaattggagaggtttag

DBGET integrated database retrieval system