KEGG   Sinorhizobium fredii NGR234: NGR_a04100
Entry
NGR_a04100        CDS       T00888                                 

Gene name
trbI
Definition
(RefSeq) conjugal transfer protein TrbI
  KO
K20533  type IV secretion system protein TrbI
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NGR_a04100 (trbI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:rhi02044]
    NGR_a04100 (trbI)
Secretion system [BR:rhi02044]
 Type IV secretion system
  Trb secretion system protein
   NGR_a04100 (trbI)
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-GeneID: 962289
NCBI-ProteinID: NP_443816
UniProt: P55406
Position
pNGR234a:complement(525304..526599)
AA seq 431 aa
MVQSLRLGAANEAEDQNGMRRLNRLPIIVAIVIVALFVGFVVIGLAWRGLPFNRNNDIHS
ASNTPATNFGDQLKRGVTDGIIGEPVKREAFQPTPTMKQKVDKEPTVVDRPTEPEERRPR
LETEEEWKARLMREQDEQIIREAQRQRMARLQARATALDSPLKVDISEGEKAPKNSTDTG
QNPTATENNASDLYPAAMKSGIMGENLDPNAQASKEDFFNQDIKDDGYLPNRVVPQMSVY
ELKRGSVIPATLITGLNSDLPGRITAQVSQNVYDSATGYRLLIPQGAKLFGRYDSKVSFG
QERVLVVWTDLIFPNGSTLQIGGMAGTDAEGYGGFKDRVDRHLWRTWSSAALIALIGTGI
DMSMPESSTLATQDTASDAVRRNFAESFGRVAEQTISKNLNVQPTIRIRPGYKFNVLVDQ
DIIFPSAYRDN
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggtccagtctctgcggcttggtgccgccaacgaggccgaagatcagaacggcatgcgc
cgtctcaatcgcctgccgatcatcgtcgccatcgtcatcgttgcgctgttcgtcggcttc
gtcgtcatcggactggcatggcgcggtcttccgttcaaccgcaacaatgatatccacagc
gcatcgaataccccggcaacgaatttcggcgaccagctcaagcgcggcgtcaccgacggt
atcatcggcgagccggtgaaacgggaagcgtttcagccgacgcccaccatgaaacagaag
gtcgacaaggaaccgactgtcgtcgaccggcctacggaaccggaagagcgacgcccgcgg
ctcgaaaccgaggaagaatggaaggcgcgcctgatgcgcgagcaggacgaacaaattatc
cgcgaggcccagcggcagcggatggcccggctgcaggcacgagcaacggctttggactcg
ccgttgaaggtggatatttccgaaggcgagaaagcacccaagaactccacggacacgggt
caaaatcccacggcgacagaaaacaatgcctcggacctctaccccgccgccatgaaatcg
gggatcatgggcgagaacctcgatccgaacgcccaggcgtcgaaggaggatttcttcaac
caggacatcaaggatgatggctacctcccaaatcgggtcgtgccgcagatgtcggtctat
gagttgaagcgcggctcggtcattcccgccaccttgatcaccggcctcaattccgacctc
ccgggtcgcatcacagcgcaggtcagccagaatgtctatgacagcgccaccggctaccgg
ttgcttatcccgcagggcgccaaactgttcgggcgctatgactcaaaggtctcgtttggc
caggagcgcgttctcgtcgtctggaccgatctcattttcccaaatggatcgaccctgcag
attggcggtatggctggcacggacgccgagggctatggtggcttcaaggacagggtcgac
cggcatctctggcgcacttggagttcggcagcgctgatcgcgctgattgggaccggaatc
gacatgtcgatgcccgagagctcgacgctggcgacacaggatactgcctcagacgccgta
cgccgaaacttcgctgaatcgttcggccgggtggctgagcagaccatatcgaagaacctg
aacgtccagccaacaatccgcatccgacccggctataagttcaatgtcctcgttgaccag
gacatcatctttccgtccgcctatcgtgacaattag

DBGET integrated database retrieval system