KEGG   Sinorhizobium fredii NGR234: NGR_b02750Help
Entry
NGR_b02750        CDS       T00888                                 

Gene name
agaL1
Definition
(RefSeq) alpha-galactosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00052  Galactose metabolism
rhi00561  Glycerolipid metabolism
rhi00600  Sphingolipid metabolism
rhi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NGR_b02750 (agaL1)
  Lipid metabolism
   00561 Glycerolipid metabolism
    NGR_b02750 (agaL1)
   00600 Sphingolipid metabolism
    NGR_b02750 (agaL1)
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     NGR_b02750 (agaL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4C Glyco_hydro_4 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-GeneID: 7789812
NCBI-ProteinID: YP_002822493
RhizoBase: NGR_b02750
UniProt: C3KNT2
Position
pNGR234b:270426..271898
Genome map
AA seq 490 aa AA seqDB search
MASFKIAIIGAGSVGFTKKLFTDILSVPELRDVEFALTDLSEHNLGMIKSILDRIVGSNN
LPTRVTATTDRRKAIEGARYIISCVRVGGLEAYADDIRIPLKYGVDQCVGDTICAGGILY
GQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAIEYGKVDTVGLCHGVQHGAEQ
IAQILGAKDGELDYVCSGINHQTWFIDVRLNGRRIGKDELVAAFEAHPVFSKQEKLRIDV
LKRFGVYSTESNGHLSEYLPWYRKRPDEITKWIDMSDWIHGETGGYLRYSTETRNWFETE
YPRFLEEAGRPLSTIKRSNEHASHILEALETGRVYRGHFNVKNDGVITNLPADAIIESPG
FVDRFGINMVSGITIPEACAATCNASINVQRMSVHAAITGDIDLLKLAVLHDPLVGAICT
PEEVWQMVDEMVVAQAEWLPQYAHAVDAAKDRLARSTVKTREWTGAARREVRSIEEIRAE
KDAAKLRAAG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttcaagatcgccattatcggcgccggcagcgtcggttttaccaagaagctc
ttcaccgacatcctgtctgtgccggagctccgcgacgtcgagttcgccctgacggacttg
agcgagcacaatctcggcatgatcaagtcgatcctcgaccggatcgtcgggtcgaacaat
ctgccgacgcgagtgacggcaaccacagatcgccgcaaggcgatcgagggtgcgcgttac
attatcagctgcgtccgcgtcggcggcctcgaggcctatgcggacgacatccgcattccg
ctgaaatacggcgtcgaccaatgcgtcggtgacacgatctgcgccggcggcatcctctac
ggccagcgcaacatcccggtgatcctcgatttctgcaaggacatccgcgaggtggccgag
ccgggcgccaagttcctgaactatgccaacccgatggccatgaacacctgggcggcgatc
gaatacggcaaggttgacacggtcggtctctgccacggcgtccagcacggcgccgagcag
atcgcccagatcctcggcgccaaggacggcgaactcgattatgtctgctcgggcatcaac
caccagacctggttcatcgacgtgcggctcaacggccgcaggatcggcaaggacgaactc
gtcgccgccttcgaggcgcatccggtcttttccaagcaggaaaagctcaggatcgacgtg
ttgaagcgcttcggcgtctattcgacggagagcaacggccatctctccgaatacctgccc
tggtaccgcaagcgtcctgacgagatcaccaaatggatcgacatgtcggactggatccat
ggcgagaccggcgggtatctgcgctattcgaccgagacccgcaactggttcgagaccgaa
tatccgcgcttcctcgaagaagcgggcaggccgctttcgacgatcaagcggtcgaacgag
catgcgagccacatcctcgaggcgctcgagacaggacgcgtctatcgcgggcatttcaac
gtcaagaatgatggcgtgatcaccaacctgccggcggacgcgatcatcgaatctcctggc
ttcgtcgatcgcttcggcattaacatggtgtccggcatcacgatccccgaggcctgtgcc
gccacctgcaacgcgtcgatcaatgtccagcgcatgtccgtgcatgcggcgatcaccggc
gacatcgatcttctgaagctcgcggtgcttcacgacccgctggtcggggcgatctgcacg
ccggaggaggtctggcagatggtcgacgaaatggtcgtcgcccaggctgaatggctgccg
caatacgcccatgccgtcgacgcggccaaggatcggctcgcccggtcgacggtgaagacc
cgcgagtggaccggtgccgcgcggcgcgaggtgcgctcgatcgaggaaatccgcgccgag
aaggacgccgcgaagctgcgcgccgccgggtag

DBGET integrated database retrieval system