KEGG   Sinorhizobium fredii NGR234: NGR_b06680Help
Entry
NGR_b06680        CDS       T00888                                 

Definition
(RefSeq) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
rhi  Sinorhizobium fredii NGR234
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NGR_b06680
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     NGR_b06680
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     NGR_b06680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-GeneID: 7788407
NCBI-ProteinID: YP_002822879
RhizoBase: NGR_b06680
UniProt: Q3V808
Position
pNGR234b:complement(670366..671364)
Genome map
AA seq 332 aa AA seqDB search
MNTSLPLAVTMGDPSGIGPEIVAKTMLARTDLRRSVVVGDPAVMAKAIASLGGGLHLNEI
HDVVDAKPDGALNILAATRIETPPAIGKVSAASGRMAYDAIVAAIELARTGKVAGMVTAP
IHKEALSAAGLPYPGHTEILAEKGGAGRVAMMLANDDIRTVLVTIHCSLADAIRQADFPA
QMSAIRLAHQGGRALGIALPRIAVAGLNPHAGEGGLFGDEEIRIIAPAIAAARAEGIDAS
GPWPGDTVFMQARNGHFDVVVAQYHDQGLIPVKYLGLEKGVNITLGLPFVRTSPDHGTAF
DIAGRGIADPRSLETAIDYARRLAKASCDQED
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctccctgccgctcgccgtcaccatgggcgatccatccggcatcgggccggag
atcgtggcaaagacgatgcttgcccgcaccgacctccgtcgcagtgtcgtcgtcggcgat
ccggccgtgatggcgaaggccatcgccagcctcggcggcggtctgcacctgaacgagatc
catgacgtcgtcgacgcgaaaccggatggggccctgaatatcctcgccgcgacccgcatc
gaaaccccacctgcaatcggcaaagtgagcgccgccagcggccgcatggcctacgatgct
atcgttgcggcgatcgaactcgccaggacgggcaaagtcgccggcatggtgacggcgccg
atccacaaggaggcgctctccgctgcggggcttccataccccggccacacggaaatcctc
gcggaaaaaggtggtgcgggacgcgtggcgatgatgctcgccaatgacgatattcgaacc
gttctggtgacgatccactgttcactggcagacgcgatccgccaggccgattttccggcc
cagatgtccgcgatacgcctcgcccaccaggggggtcgtgcgttgggaatcgcccttccg
cgcatcgccgttgcggggctcaatccgcatgcgggtgaagggggtctcttcggagacgag
gaaatccgcatcatcgcgcccgccatcgcggcagcccgcgcggaaggcatagacgccagc
ggcccctggcccggcgatactgttttcatgcaggcgcgaaacggccacttcgatgtggtc
gtcgcgcagtatcacgaccaggggctgatcccggtcaagtatctcggactggaaaagggc
gtgaacatcacgctcggcctgcccttcgtgcgcacaagccccgaccacggcaccgccttc
gatatcgccggccgtggcattgccgatccgaggagtctcgaaacagcgatcgactacgcc
cgccgactggcgaaggcatcgtgcgaccaggaggattga

DBGET integrated database retrieval system