KEGG   Sinorhizobium fredii NGR234: NGR_b20140Help
Entry
NGR_b20140        CDS       T00888                                 

Definition
(RefSeq) pyridoxal-dependent decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00350  Tyrosine metabolism
rhi00360  Phenylalanine metabolism
rhi00380  Tryptophan metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NGR_b20140
   00360 Phenylalanine metabolism
    NGR_b20140
   00380 Tryptophan metabolism
    NGR_b20140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhi04147]
    NGR_b20140
Enzymes [BR:rhi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     NGR_b20140
    4.1.1.105  L-tryptophan decarboxylase
     NGR_b20140
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NGR_b20140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 Aminotran_5 OKR_DC_1 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 7789336
NCBI-ProteinID: YP_002824214
RhizoBase: NGR_b20140
UniProt: C3KM25
Position
pNGR234b:2060382..2061800
Genome map
AA seq 472 aa AA seqDB search
MDEATFAKWSRKAADWGAAYRASLRDRPVRAQTAPGDITAEIPASPPQTGESMEAIFADF
EKIIVPGMTHWQHPRFFAYFPANAAPVSVVAEYLVTAMAAQCMLWQTSPAATELETRVLD
WLRQAIGLPGGFAGVIQDSASSATLSAVLVMRERALAWNGNKAGLSANPRLRVYSSDQVH
TSIDRAIWVSGVGEDNLVRIPVQGEHRSMDCAALEAAILRDKAAGYVPAGVIACTGGTST
GACDNIADVVRVARAHDLYVHVDAAWAGSAMICEEFRPLWAGVEEADSVVFNPHKWLGAQ
FDCSAHFIRSPDDLVRTLAIKPEYLKTHGKDGIINYSEWTVPLGRRFRALKLWFLLRFHG
LEGLKGMIRNHVAWAETLAERLGREDGFEIVTKPIFSLFSFRHLGSGDLDAHNLALVNAI
NDDGRIYLTQTRVDGRVVIRFQAGQFDMTEQDADTAFEVITEIANSLGAARR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagccacgttcgccaaatggtcgagaaaggccgcagactggggagccgcttac
cgcgcttcgcttcgcgaccggccggtgcgcgcgcaaacggcgcccggcgacatcaccgct
gagataccagcctccccgccgcagaccggcgagagcatggaggcgatctttgccgatttc
gagaaaatcatcgttccggggatgacgcactggcagcacccgcgcttcttcgcctatttc
ccggccaatgccgcgccggtttccgtcgtcgccgagtatctggtgacggcgatggccgcc
cagtgcatgctctggcagacgtcacctgccgcaaccgagctcgaaacgagggtgctcgac
tggctgcgccaggcgatcggcctgccgggaggtttcgccggcgtaatccaggattcggcc
tcctccgccaccctgtcggccgtcctcgtcatgcgcgagcgcgcgctggcctggaacggc
aacaaggcggggcttagcgccaatccgagactgcgcgtctattcctcggatcaggttcac
acgtcgatcgaccgcgccatctgggtctccggcgtcggcgaggacaatctcgtacgtatc
ccggttcagggtgaacaccgttcgatggattgtgcggcgctggaagcggcgatcctccgc
gacaaggcagccggctacgtgcccgccggcgtcatcgcctgtacaggcggcacgagcacc
ggcgcctgcgacaatatcgctgacgtcgttcgggtcgcccgcgcccatgacctttacgtg
catgtggacgcggcctgggccggctcggcgatgatctgcgaggaattccggcccctctgg
gccggcgtcgaggaagccgattccgtcgtcttcaacccgcacaagtggctcggcgcccag
ttcgactgctcggcgcatttcatccgaagcccggacgacctggtccgtacgctggcgatc
aagccggaatatttgaagacccacggcaaggacggcatcataaactattccgaatggacg
gtgccgcttggccggcgcttccgggcgctcaagctctggttcctcctgcggttccatggc
ctggaagggctgaaaggaatgatccgcaaccacgtcgcctgggcggagacgcttgccgag
cggctcggccgggaggacgggttcgagatcgtcacgaaaccgatcttctcgctcttctcc
ttccggcacttgggcagcggcgacctcgacgcccacaatctcgccctcgtcaacgccatc
aacgatgacgggcggatctacctgacccagacccgcgtcgatggacgggtggtgatccgt
ttccaggccgggcagttcgatatgactgagcaggacgccgacacggccttcgaggtcatc
accgaaatcgccaacagccttggcgccgcccgaaggtag

DBGET integrated database retrieval system