KEGG   Sinorhizobium fredii NGR234: NGR_b21680Help
Entry
NGR_b21680        CDS       T00888                                 

Definition
(RefSeq) mandelate racemase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00051  Fructose and mannose metabolism
rhi01100  Metabolic pathways
rhi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NGR_b21680
Enzymes [BR:rhi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     NGR_b21680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C PepSY Kin17_mid
Motif
Other DBs
NCBI-GeneID: 7789489
NCBI-ProteinID: YP_002824366
RhizoBase: NGR_b21680
UniProt: C3KMJ8
Position
pNGR234b:complement(2224485..2225762)
Genome map
AA seq 425 aa AA seqDB search
MTRIVDLRVFDLRFPTSQSLDGSDAMNPDPDYSAAYVILDTDQPGLSGHGLTFTIGRGND
ICCMAIKAMRHLVVGQEIEVIRNQPGHFWRHLTGDSQLRWIGPEKGAIHLATGAIVNAVW
DLIAKEAGKPVWRLVAEMSAEEIADIVDYRYLTDVLTREDAIDILKRAEPGKAARIAMLG
REGYPCYTTSAGWLGYGDEKLRRLAEEAVDAGFNHVKMKVGRDRADDIRRLTIAREVLSP
DRYLMIDANQVWDVDEAIDWVKALSFAKPFFIEEPTSPDDVAGHRKIRAAIAPIKVATGE
MCQNRILFKQFIAEGAIDIVQVDACRLGGLNEVLAVLLMAAKYRLPVWPHAGGVGLCEYV
QHLSMIDYVAVSGTKDGRVIEYVDHLHEHFVDPCVISNAAYMPPQRPGFSIEMKPQSIET
YTYRP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcatcgtcgatctccgcgtctttgacctgcgctttccgacgtcgcaaagcctc
gacggatcggacgcgatgaatccggacccggactattctgccgcctatgtcattctcgac
accgaccagccggggctctccggccacggccttaccttcaccatcggccgcggcaacgac
atctgctgcatggcgatcaaggcgatgcgccaccttgtcgtaggccaggagatcgaggtc
attcgcaaccagccgggccacttctggcggcatctgaccggcgacagccagttgcgctgg
atcgggccggaaaagggggcgatccatctcgccaccggggcgatcgtcaatgccgtgtgg
gatctgatcgccaaggaagcgggcaagccggtctggcgtctcgtggccgagatgtcggca
gaggagatcgccgatatcgtcgattaccgctatctgaccgatgtgctgacgcgcgaggac
gcgatcgatatcctcaaacgcgccgagcccggcaaggcggcgcgcatcgcgatgctcggg
cgggagggctatccctgctatacgacctccgccggctggctcggctacggtgacgagaaa
ctccggcggcttgctgaggaggcggtcgacgccggcttcaaccacgtcaagatgaaggtc
gggcgcgaccgtgccgacgatatccgccggctgacgatcgcccgcgaggttctcagtccc
gatcgttacctgatgatcgacgccaaccaggtctgggatgtcgacgaggcgatcgactgg
gtgaaggcgctttccttcgccaagccctttttcatcgaggagccgaccagtcccgacgat
gtcgccggccaccgcaagatccgcgcggcaatcgcgcccatcaaggtcgcgaccggcgag
atgtgccagaaccgcattctcttcaagcagttcatcgccgaaggcgcgatcgacatcgtc
caggtcgacgcctgccgcctcgggggcctgaacgaggttcttgccgtcctgctgatggcg
gcgaaatatcggctgccggtgtggccgcatgccggcggcgtgggcctctgcgagtatgtg
cagcatctgtcgatgatcgattatgtcgccgtatccggcaccaaggacggccgcgtgatc
gagtatgtcgaccatctgcatgagcatttcgtcgatccctgcgtcatcagcaacgccgcc
tatatgccgccgcagcggcccggcttctcgatcgagatgaaacctcagtcgatcgagacc
tacacttatcgcccatag

DBGET integrated database retrieval system