KEGG   Sinorhizobium fredii NGR234: NGR_b23530
Entry
NGR_b23530        CDS       T00888                                 

Gene name
mocB
Definition
(RefSeq) rhizopine-binding protein precursor MocB
  KO
K17213  inositol transport system substrate-binding protein
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NGR_b23530 (mocB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhi02000]
    NGR_b23530 (mocB)
Transporters [BR:rhi02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Inositol transporter
    NGR_b23530 (mocB)
SSDB
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Peripla_BP_3 Peripla_BP_6 YflT
Other DBs
NCBI-GeneID: 7788901
NCBI-ProteinID: YP_002824549
RhizoBase: NGR_b23530
UniProt: C3KNG6
Position
pNGR234b:2421072..2422016
AA seq 314 aa
MKSICTAAVVALLMAGTASAETIGVSMQSFDNNFQTLLRQGLDARAAEVNGVNLQIEDAQ
TDISKQRSQVDNFIASGVDAIIMTLADTSAAPGISEAAKKAGIPLVYLNLEPENLGQLPD
KQAYVGSKETDSGRLGAEAACALLKKKGKAGDAQAYILMGDLAHQASRDRTSSVKETLAA
GDCKGVTIADEQSAAWTRTNAMDLTTNWITAGRPIDVIFANNDEMAIGAIQALKAAGTSM
EDVIVVGIDATQDALAAMAAGDLDVTVFQNAKGQSASAVDAAVALAQGKNVEKTVWVPFE
LVTPENMDQYSQKN
NT seq 945 nt   +upstreamnt  +downstreamnt
atgaaatcaatctgtacggcggccgttgtggccctcttgatggcaggcactgcctcggcc
gagacgatcggcgtttcgatgcagagcttcgacaacaacttccagacactgctgcgccag
ggcctcgatgcaagggccgccgaggtgaacggcgtcaatcttcagatcgaggatgcgcag
accgacatctccaagcagcgcagccaggtggacaacttcatcgcctcgggggtggacgcg
atcatcatgaccctggcggatacgtcggccgcgccgggcatcagcgaggcggcgaagaag
gctggcattccgctcgtctacctcaatctcgagccggaaaatctcggtcagctgcccgac
aagcaggcctatgtcggttcgaaggaaaccgactcgggcaggctcggtgccgaggccgcc
tgcgcgctgctgaagaaaaagggcaaggccggcgatgcgcaggcctacatattgatgggc
gatctggctcaccaggcgtcgcgcgatcgcacctcgtcggtcaaggaaacgctggcggca
ggcgactgcaagggcgtgaccatcgccgacgagcagtccgccgcctggacgcgcaccaac
gcgatggacctgacgacgaactggatcaccgccggccggccgatcgacgtgatcttcgcc
aacaatgacgagatggcgatcggcgcgatacaggcactgaaggccgcgggaacctcgatg
gaggatgtgatcgtcgtcggcatcgatgcgacgcaggatgcccttgccgcgatggcggcc
ggtgatctggacgtgaccgtattccagaacgccaagggacagtcggcaagtgccgtggat
gcagccgtcgcgctggcgcagggcaagaacgtcgaaaagacggtctgggtgcccttcgaa
ctggtcacgcccgagaacatggaccagtacagccaaaagaactga

DBGET integrated database retrieval system