KEGG   Sinorhizobium fredii NGR234: NGR_c01680Help
Entry
NGR_c01680        CDS       T00888                                 

Gene name
fadA
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00071  Fatty acid degradation
rhi00072  Synthesis and degradation of ketone bodies
rhi00280  Valine, leucine and isoleucine degradation
rhi00310  Lysine degradation
rhi00362  Benzoate degradation
rhi00380  Tryptophan metabolism
rhi00620  Pyruvate metabolism
rhi00630  Glyoxylate and dicarboxylate metabolism
rhi00640  Propanoate metabolism
rhi00650  Butanoate metabolism
rhi00900  Terpenoid backbone biosynthesis
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
rhi01212  Fatty acid metabolism
rhi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NGR_c01680 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    NGR_c01680 (fadA)
   00640 Propanoate metabolism
    NGR_c01680 (fadA)
   00650 Butanoate metabolism
    NGR_c01680 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NGR_c01680 (fadA)
   00072 Synthesis and degradation of ketone bodies
    NGR_c01680 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NGR_c01680 (fadA)
   00310 Lysine degradation
    NGR_c01680 (fadA)
   00380 Tryptophan metabolism
    NGR_c01680 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NGR_c01680 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NGR_c01680 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NGR_c01680 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhi04147]
    NGR_c01680 (fadA)
Enzymes [BR:rhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NGR_c01680 (fadA)
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NGR_c01680 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C TRI9
Motif
Other DBs
NCBI-GeneID: 7790746
NCBI-ProteinID: YP_002824721
RhizoBase: NGR_c01680
UniProt: C3MFR7
Position
complement(186212..187420)
Genome map
AA seq 402 aa AA seqDB search
MTKVFVYDHVRTPRGRGKKDGSLHEVPSVRLAAKVLEAVRDRNGLDTATVDDIVMGCVDP
VMDAGSVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAKIAQGADDIVIAGGVES
MSRVGLGMSGGSWFMDPSVSLPAYFMPQGVSADLIATKYGFSRDDVDAYAVESQKRAAHA
WEKGYFENSVVPVKDQNGLTILDRDEHMRPGTDMQALASLNPSFQMPGEMGGFEAVAIQA
HPEIERINYVHHAGNSSGIVDGAAAVLLGSKAGGEAMGLKPRARIRAFANIGSDPALMLT
GPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRFMQAFDIPHDQINVNGGAIAMGHPL
GATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaagtcttcgtttacgaccacgtgcgcacgccgcgcggccgtggcaagaaggac
ggctcgctgcacgaagtgccgtccgtccggctcgccgccaaggtgctcgaggcggtccgc
gaccgcaacgggctcgacaccgcgaccgtcgacgacatcgtcatgggctgcgtcgatccg
gtgatggatgcagggtcggtgatcccgaaggcggccgctttcgaggcgggctactcgacg
agggcgcccggcatgcagatctcccgcttctgcgcctccggtctcgacgccgtcaatttc
ggcgccgccaagatcgcgcaaggggcggacgacatcgtcattgccggcggcgtcgagtcg
atgtcgcgcgtcggcctcggcatgtcgggcggctcctggttcatggatccctccgtcagc
ctgccggcctatttcatgccgcagggcgtctcggccgacctgatcgccaccaaatacggc
ttctcgcgcgacgacgtcgacgcctatgcggtggaaagccagaagcgcgctgcgcacgcc
tgggaaaagggctatttcgagaactcggtcgtgccggtcaaggaccagaacggcctgacg
atcctcgaccgcgacgagcatatgcgccccggcaccgacatgcaggcactcgcctcgctc
aacccctccttccagatgcccggcgagatgggcggcttcgaggccgtcgccatccaggcg
catccggaaatcgagcggatcaactatgtccaccacgccggcaattcgtccggcatcgtc
gatggcgcagccgccgtgctgctcggctcgaaggccggcggcgaagccatggggctgaag
ccgcgcgcccgcatccgcgccttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgacgttactgaaaagctgctgaagcgcgccgacatgaagctctccgacatc
gacctcttcgagctcaacgaggcctttgccgccgtagtgctgcgcttcatgcaggccttc
gacattccgcacgaccagatcaacgtcaacggcggcgccatcgccatgggccatccgctc
ggcgcgaccggcgcgatgatcctcggcacggtgctcgacgagctcgaacgccgcgacctc
aacaccgctctggtgacgctctgcatcggcgccggcatgggcaccgccacgatcatcgaa
cgcgtctga

DBGET integrated database retrieval system