KEGG   Sinorhizobium fredii NGR234: NGR_c02450Help
Entry
NGR_c02450        CDS       T00888                                 

Definition
(RefSeq) rhamnose ABC transporter, periplasmic rhamnose-binding protein
  KO
K10559  rhamnose transport system substrate-binding protein
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NGR_c02450
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rhi02000]
    NGR_c02450
Transporters [BR:rhi02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Rhamnose transporter
    NGR_c02450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_4 Peripla_BP_1 Glycos_transf_2
Motif
Other DBs
NCBI-GeneID: 7790823
NCBI-ProteinID: YP_002824796
RhizoBase: NGR_c02450
UniProt: C3MFZ2
Position
286363..287352
Genome map
AA seq 329 aa AA seqDB search
MKILKSLMVTAAVAAALMANAAHAENKKIALVVKALGIGFFEAANKGAQEAAKELGDVEI
IYTGPTSTTAEGQIEVINSLIAQKVDAIAVSANDTDALVPALKKAMDRGIKVISWDSGVA
KEGRLMHLNPSSSPLIGNMIIKLAADNLPEGGDVAVLSASATATNQNTWIAEMKKVQVNY
KGINVVATVYGDDLADKSYRETQGLIQSHPNLKAIIAPTSIGIVAAAQAVTDAGKIGQIN
VTGLGLPSEMAGHVKSGASKSFAIWNPIDLGYSATMIAYDIINGAEAKPGAELKMGRMGT
VKLDDNNEGAMADPFVYDASNVEEFAKIF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattctcaaatcattgatggtgacggccgccgtcgcggccgcgctcatggcgaac
gccgctcatgcggagaacaagaagatcgcgctcgtcgtcaaggcgctcggcatcggcttc
ttcgaggccgccaacaagggtgcccaggaagcggccaaggaactcggcgacgtcgagatc
atctataccggtccgacttcgacgacagccgagggccagatcgaggtaatcaattcgctg
atcgcccagaaggtcgatgcgatcgcggtttcggccaacgacaccgacgcactcgtaccg
gcgctcaagaaggcgatggaccgcggcatcaaggtgatttcctgggattcgggtgtcgcc
aaggaaggccggctgatgcatctcaacccgtcgtcgagcccgctgatcggcaacatgatc
atcaagctcgccgccgataacctgccggaaggcggcgatgtcgccgtgctctcggcctcg
gcaacggcaaccaaccagaacacctggattgccgagatgaagaaggtccaggtcaactac
aagggcatcaacgtcgtggccacagtctatggcgacgaccttgccgacaagtcctaccgt
gagacgcagggcctcatccagtcccatccgaacctgaaggcgatcatcgcgccgacctcg
atcggcatcgtcgcggccgcccaggccgtcaccgacgccggcaagatcggccagatcaac
gtcaccggtctcgggctgccctccgaaatggccggtcatgtgaagtccggcgcgtccaag
tccttcgcgatctggaacccgatcgacctcggctattcggcgacgatgatcgcctatgac
atcatcaacggtgccgaagccaaacccggtgcggaactgaagatgggccgcatgggaacg
gtcaagctcgacgacaacaacgaaggcgccatggccgacccgttcgtctatgatgcctcg
aacgtcgaagagtttgccaagatcttctga

DBGET integrated database retrieval system