KEGG   Sinorhizobium fredii NGR234: NGR_c04560Help
Entry
NGR_c04560        CDS       T00888                                 

Gene name
ispE
Definition
(RefSeq) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00900  Terpenoid backbone biosynthesis
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NGR_c04560 (ispE)
Enzymes [BR:rhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NGR_c04560 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Phage_attach
Motif
Other DBs
NCBI-GeneID: 7791682
NCBI-ProteinID: YP_002825005
RhizoBase: NGR_c04560
UniProt: C3MHC4
Position
complement(507667..508635)
Genome map
AA seq 322 aa AA seqDB search
MPRRRCRRSPPRRTRNPDSMPADGIAGFALTLAAPAKINLALHVVGQRADGHHLLESLVT
FAECGDRIAFAPADADHFTVSGPFSRDLPVSADGKSGNLVLRARDLLRRELIGRGAPTTS
VHLHLEKNLPIASGIGGGSADAAATLRGLLSLWKAEIAPERLASLALELGADVPMCLDGR
PLLARGIGEEIAPLADLPSFAIVLVNPLVAVSTPVIFRMLAEKRNPPLALPHGAHTAAAW
LAALADMRNDLERPARALEPAVETVSDALQAVRADLVRMSGSGATCFGLFDSDEKAGAAA
QRISADQPGWYVLATRTAGKRG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggagacgctgccgaagaagcccgccgcgccggacaagaaatcctgatagcatg
ccggccgacggcatcgccggcttcgcgctgacccttgcggcgccggccaagatcaacctg
gcactgcatgtcgtcggtcagcgcgccgacggacatcatcttctggaaagcctcgtcacc
ttcgcagagtgcggcgaccggatcgcattcgcgccagcggatgccgaccacttcaccgta
tccggcccgttttcgcgcgatctgccggtctcggcggacggcaagagcggcaatctggta
ttgcgggctcgcgatcttttgcggcgggagctgatcggacggggcgctccgaccacctct
gtgcatctgcatctggagaagaacctgccgatcgcctccgggatcggcgggggctcggcc
gacgcggccgccacgcttcgcggcctgctttcgctctggaaagccgagatcgcgccggaa
aggctcgccagcctcgccctggaacttggcgccgatgtgccgatgtgtctcgacggcagg
ccgctgcttgccagggggatcggcgaagagatcgccccgcttgccgatctgccgtccttt
gcgatcgttctcgtcaatccgctcgtcgccgtctcgacgcccgtcatctttcggatgctc
gccgagaagcgcaatcctcccctcgccctgccgcacggcgcccataccgccgcggcctgg
ctggcagccctcgccgacatgcgcaacgatctggagcggccggcgagagcgctggaaccg
gcggtcgagacggtatcggacgcgttgcaagcggtgcgtgccgatctcgtacggatgtcc
ggctcgggcgccacgtgtttcggtctgttcgacagcgacgaaaaggcgggcgcggccgcg
cagcgcatttccgccgatcagccgggatggtacgttctagccacccgaaccgcggggaag
cgaggataa

DBGET integrated database retrieval system