KEGG   Sinorhizobium fredii NGR234: NGR_c08970Help
Entry
NGR_c08970        CDS       T00888                                 

Gene name
gmk
Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00230  Purine metabolism
rhi01100  Metabolic pathways
Module
rhi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NGR_c08970 (gmk)
Enzymes [BR:rhi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NGR_c08970 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_22 Fic_N AAA_18 Mg_chelatase AAA_29 RsgA_GTPase AAA_30 Viral_helicase1 ABC_tran Adeno_IVa2 cobW AAA_24
Motif
Other DBs
NCBI-GeneID: 7792122
NCBI-ProteinID: YP_002825440
RhizoBase: NGR_c08970
UniProt: C3M9C1
Position
953681..954340
Genome map
AA seq 219 aa AA seqDB search
MKSATASPIRIARRGLMLVISSPSGAGKSTIARNLLEADPELTISVSVTTRAKRSSEIEG
RHYHFKTVREFEALRATDSLLEWAEVHGNFYGTPRDAVEAAMADGRDMLFDIDWQGAQQL
QEKMAGDVVSIFILPPSMAELQSRLHRRAEDTEEVIATRLANSRAEIEHWREYDYIVLND
DLDRAFSSVRAIIEAERLRRDRRPGLFEFVNGLLTENPF
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcggcgactgcttcgcccatcaggatcgcccgtcgcggattgatgcttgtgatc
tcgtcgccctcaggcgccggaaaatcgacgatcgcgcgcaatctcctcgaggccgatccg
gaactgaccatttcggtgagtgtcacgacgcgcgccaagcggtcgagtgagatcgagggg
cggcattatcatttcaagaccgtccgcgaattcgaggcattgagggcgacggactcgctg
ctcgagtgggccgaggtgcacggcaatttctacggaacaccgcgcgacgccgtcgaggcc
gcgatggccgacgggcgcgacatgctcttcgacatcgactggcagggtgcgcagcaattg
caggaaaagatggccggcgacgtggtgtcgatcttcatcctgccgccgtccatggcggaa
ctgcagtcgcgcctgcatcggcgcgccgaagataccgaggaagtgatcgcaacgcggctc
gccaattcgcgcgcggagatcgagcactggcgcgaatacgactatatcgtcctcaatgac
gatctcgaccgcgccttctcttccgtgcgcgcgatcatcgaagcggagcgactgcgccgc
gaccggcgccctggcctgttcgaattcgtcaacggtcttctgacggaaaacccgttctga

DBGET integrated database retrieval system