KEGG   Sinorhizobium fredii NGR234: NGR_c12570Help
Entry
NGR_c12570        CDS       T00888                                 

Gene name
folE
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00790  Folate biosynthesis
rhi01100  Metabolic pathways
Module
rhi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NGR_c12570 (folE)
Enzymes [BR:rhi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     NGR_c12570 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 7793130
NCBI-ProteinID: YP_002825791
RhizoBase: NGR_c12570
UniProt: C3MB45
Position
complement(1294642..1295259)
Genome map
AA seq 205 aa AA seqDB search
MDAIVKNFPLLDDTSGRPTQKEAEEAVRVLLRWAGEDPTREGLKDTPARVIKSYREIFGG
YDLVAEDVLGRTFEEVSGYDDIVLEKDVPFYSHCEHHMVPIIGKAHVAYLPNGRVLGLSK
IARVVDIYARRLQTQEAMTAQIARAIDETLAPRGVAVMIEAEHLCMAMRGIKKHGSTTLT
TTFTGAFKTEPAEQARFMTLLRGFK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatagtaaagaatttccctctgctcgacgacaccagcggtcggccgacgcag
aaagaagccgaggaagctgttcgcgtgctgctgcgctgggcaggcgaagaccccacccga
gagggtctcaaggacacgccggcgcgtgtcatcaaatcctatcgcgaaattttcggcggc
tacgatctcgtcgccgaggacgtgctcggccggaccttcgaggaagtctccggctacgac
gacatcgtgctcgagaaggacgttccgttctattcgcattgcgaacaccacatggtgccg
atcatcggcaaggcacatgtcgcctatctgccgaacggccgcgtcctgggcctctccaag
atcgcccgcgtcgtcgacatttacgcgcgccgcctgcagacgcaggaagcaatgacggca
cagatcgccagggccatcgacgagacgcttgctccgcgcggcgtcgccgtgatgatcgag
gccgagcacctgtgcatggcgatgcgcggcatcaagaagcacggctcgactacgctgacg
accacctttaccggtgcgttcaagaccgagccggccgagcaggcccgtttcatgaccctg
ttgaggggcttcaagtaa

DBGET integrated database retrieval system