KEGG   Sinorhizobium fredii NGR234: NGR_c23620Help
Entry
NGR_c23620        CDS       T00888                                 

Definition
(RefSeq) cytochrome c family protein
  KO
K08738  cytochrome c
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NGR_c23620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 7790018
NCBI-ProteinID: YP_002826874
RhizoBase: NGR_c23620
UniProt: C3MFR4
Position
complement(2457919..2458221)
Genome map
AA seq 100 aa AA seqDB search
MRSIILAACLALVAAPSLADGDAKAGAAVFRKCSACHTATEPANRVGPSLMGVVGRPAAS
FDGYSYSDAMKAFGAEGKVWDEATLSEYLLSPRGMVSGTR
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatccatcatcctcgccgcctgtcttgccctcgtcgcggcgccaagcctggcggac
ggggacgccaaggcgggtgcggcggtcttcaggaaatgcagtgcctgccatacggccacg
gagccggcgaaccgggttggcccgagcctgatgggcgtcgtcggccgtcccgccgcgtcg
ttcgacgggtatagctattccgatgcgatgaaggcattcggcgctgaaggcaaagtgtgg
gacgaggcgacgctctcggaatatctcctgagcccccgggggatggtgagcgggacaaga
tga

DBGET integrated database retrieval system