KEGG   Sinorhizobium fredii NGR234: NGR_c26300Help
Entry
NGR_c26300        CDS       T00888                                 

Gene name
fdhA1
Definition
(RefSeq) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00625  Chloroalkane and chloroalkene degradation
rhi00680  Methane metabolism
rhi01100  Metabolic pathways
rhi01120  Microbial metabolism in diverse environments
rhi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    NGR_c26300 (fdhA1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NGR_c26300 (fdhA1)
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     NGR_c26300 (fdhA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD DUF934 ADH_N_assoc FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 7790286
NCBI-ProteinID: YP_002827140
RhizoBase: NGR_c26300
UniProt: C3MHA1
Position
complement(2731967..2733154)
Genome map
AA seq 395 aa AA seqDB search
MSKNRGVVYMRPGKVEVRDIDDPKLEAPDGRRIEHGVILKVISTNICGSDQHMVRGRTTA
MPGLVLGHEITGQVIEKGVDVEMLDIGDIVSVPFNVACGRCRCCKSQDTGVCLTVNPSRA
GGAYGYVDMGGWIGGQARYVTVPYADFNLLKFPDRDRAMEKIRDLTMLSDILPTGFHGAI
NAKVGVGSIVYVAGAGPVGLAAAASARILGAAVVMVGDFNRDRLAHAAKVGFEPIDLNAG
DNLGEMIAQVTGSNEVDSAIDAVGFEARGHSGGEQPAIVLNQMMEITRAAGSIGIPGLYV
TEDPGAVDNAAKHGSLSLRLGLGWAKAQSFHTGQTPVLRYNRQLMQAILHDRLPIADIVN
AKVISLEDAVQGYESFDQGVAQKFVLDPHGELKAA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacagaggtgtcgtctacatgcggcccggcaaggtcgaagtgcgagatatc
gacgatccgaagctcgaggcgccggacggccgccgcatcgaacatggcgtgatcctcaaa
gtgatctccaccaatatctgcggctcggaccagcatatggtgcgcggccggacgacggcc
atgcccgggctcgtgctcggccatgagatcaccggacaggtgatcgagaagggcgttgat
gtcgagatgctcgacatcggcgacatcgtctctgttcccttcaacgtcgcctgcggccgg
tgccgctgctgcaagtcgcaggacaccggcgtctgcctcacagtcaatccgtcgcgcgcg
ggcggcgcctacggctatgtggacatgggcggctggatcggcggacaggcgcgctacgtg
acggtgccctatgccgacttcaatcttctgaagttccccgatcgggaccgcgcgatggag
aagatccgcgacctgaccatgctttcggacatcctgccgacgggcttccacggcgcgatc
aacgcgaaggtcggcgtgggctcgatcgtctacgtcgccggcgccgggcctgtcggcctg
gccgctgcggcttcggcccgcatcctgggcgcagctgtcgtcatggtcggcgatttcaac
agggaccgcctcgcccatgccgccaaggtcggcttcgagccgatcgacctcaatgccggc
gacaatctgggcgaaatgatcgcccaggtgaccggcagcaacgaggtggacagcgccatc
gatgcggtcggcttcgaagcgcgcggccatagcggcggcgaacagccggcgatcgtgctg
aaccagatgatggaaatcacccgtgccgcgggctcgatcggaattccgggcctctatgtg
acggaagatcccggcgcggtcgacaacgctgccaagcacggcagcctctcgcttcgcctc
ggcctgggctgggccaaggcgcagtccttccacacggggcagacgcccgtgcttcgctac
aacagacagttgatgcaggccatcctgcacgatcgtctgccgatcgccgatatcgtcaat
gcgaaggtcatttcgctcgaggatgcggtgcaaggctacgagagtttcgaccagggcgtc
gcccagaagttcgtgctggatccgcatggtgagttgaaggccgcttaa

DBGET integrated database retrieval system