KEGG   Sinorhizobium fredii NGR234: NGR_c29760Help
Entry
NGR_c29760        CDS       T00888                                 

Gene name
cobL
Definition
(RefSeq) decarboxylating precorrin-6Y C(5,15)-methyltransferase
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00860  Porphyrin and chlorophyll metabolism
rhi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NGR_c29760 (cobL)
Enzymes [BR:rhi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     NGR_c29760 (cobL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase PCMT Methyltransf_4 Cons_hypoth95 Methyltr_RsmB-F LPD22 Methyltransf_18
Motif
Other DBs
NCBI-GeneID: 7792248
NCBI-ProteinID: YP_002827472
RhizoBase: NGR_c29760
UniProt: C3M908
Position
complement(3122826..3124082)
Genome map
AA seq 418 aa AA seqDB search
MRGLPVADMSNSVSAMVAPWLTVIGIGEDGVAGLGDEAKRLIAAAPVVFGGVRHLELAAS
LIHGESEAWQSPFEKSVEAIVSRRGSPVVVLASGDPFLYGVGATLARRIDASEIRTIPAP
SAFSLAASRLGWALQELATVSLHGRPLDLIRPHLQPGARILALTSDENGPNALAGLLGEC
GFGQSRLTVLEALGGERERVSRHLASSFTLEKVNALNLCAVEVVADGSARVLSLAGGRDD
SLFEHDGQITKREVRALTLSALAPRKGELLWDIGAGSGSIAIEWMLADPAMRAIAVEASP
ERAARIGRNAARFGVPGLSVVEGQAPDALRGLARPDVIFIGGGGSETGVMEAAVAALPAG
GRLVANAVTTEMEAVLIAHHARLGGSLVRIDIARAAPVGTMTGWRPAMPVTQWSWVKA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggtctgcccgtggctgacatgtcgaatagcgtctcggccatggtcgctccctgg
ttgaccgtcatcggtatcggggaggatggtgtagccggtctcggcgacgaggccaagcgg
ctgattgcggcagcccccgtcgtcttcggcggcgtccgccatcttgagctcgcggcatcc
ctgatccacggcgagagcgaggcctggcagagccctttcgaaaagtcggttgaggcgatc
gtttcaaggcgagggagccccgtcgtggtgctcgcctccggcgaccctttcctctacggc
gtcggcgccacgctggcgcgccgtatcgatgccagcgaaatccgcacgatcccggcgcct
tcggccttcagcctcgcagcgtcgcggctcggttgggcgctgcaggagctggcaaccgtc
tcgctgcatggccgcccgctcgatctcatccggccgcacttgcagccgggcgcccgcatt
ctggcgctgacctcggacgagaacggcccgaatgcgctcgccggactgcttggcgaatgc
ggcttcggtcagtcccggcttaccgtcctcgaagccctcggcggggaacgcgagcgcgtt
tcccggcaccttgcttcgagcttcacactggaaaaggtcaacgccttgaacctctgcgcc
gtcgaggtcgtcgcggatggcagtgcccgcgtcctgtctcttgccggcggccgcgacgat
tcactcttcgagcatgacggccagatcaccaagcgcgaggtgcgggcgctgacgctatcg
gcgctggcgccgcgcaagggcgagcttctctgggacatcggcgccggctccggctcgatc
gccatcgaatggatgctggcggatccggcaatgcgggcgatcgccgtcgaagcttcgccc
gagcgggcggcacggatcggccgcaatgcggcgcgtttcggggtcccgggattgtccgtc
gtcgaaggccaggcgccggacgcgcttcgcgggctggcccgcccggacgtgatcttcatc
ggtggcggcggcagtgaaaccggcgtcatggaggcggcagtcgccgcacttcccgccggc
ggtaggcttgtcgccaatgccgtcacgacggaaatggaagcggtgcttattgcccatcac
gcccggctcggcggttcgctcgtccgcatcgacatcgcccgcgccgctcccgttggcacc
atgacgggctggcgaccggcgatgccggtgacgcaatggtcctgggtcaaggcctga

DBGET integrated database retrieval system