KEGG   Sinorhizobium fredii NGR234: NGR_c29950Help
Entry
NGR_c29950        CDS       T00888                                 

Definition
(RefSeq) maleylacetoacetate isomerase protein
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00350  Tyrosine metabolism
rhi00643  Styrene degradation
rhi01100  Metabolic pathways
rhi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NGR_c29950
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    NGR_c29950
Enzymes [BR:rhi01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     NGR_c29950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 7792267
NCBI-ProteinID: YP_002827491
RhizoBase: NGR_c29950
UniProt: C3M927
Position
complement(3142603..3143241)
Genome map
AA seq 212 aa AA seqDB search
MTETVLYDYWRSSASYRVRIALNLVGEGYRSVPVDLLAKAHRAPEHLARNPQGLVPVLDI
DGERLTQSLAIVEYLAETRPQVGFLPADVIGRQRVRALSYAVAMDIHPICNLGVVAHVMA
AAQDGEAARRAWMQKFIGEGFAAFESLLDHPSTGSYCHAESPTMADICLVPQVYNARRWE
VDLSGCPRIVAIDARCAEIDGFARAHPDRVRP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaccgtcctctacgactattggcgttcgtcggcgagctatcgggtgcggatc
gccctcaatctcgtcggcgaaggctaccgctccgtcccggtcgatcttctcgccaaggcg
catcgcgcgcccgagcatctcgcccgcaatccgcagggtctggtgccggtactggacatc
gatggcgagcgcctcacccagtcgctcgccattgtcgagtaccttgcggaaacaaggccg
caggtcggcttcctgcctgccgacgtgatcggccgacagcgggtgcgggcgctatcctat
gccgtcgccatggacatccatcccatctgcaatcttggcgtggtcgctcatgtgatggcc
gccgctcaggacggcgaggcggcgcgccgggcctggatgcagaagttcatcggcgaggga
tttgccgcgttcgagtcgctgctcgatcatccctcgaccgggagctactgtcacgcagag
agcccaaccatggcggatatctgcctcgtgccgcaggtctacaatgcgcgccgctgggag
gtcgatctttccggttgccctcggatcgtcgccatcgatgcgcgctgcgccgagatcgac
ggctttgcgcgggcgcatcccgaccgggtgaggccgtag

DBGET integrated database retrieval system