KEGG   Sinorhizobium fredii NGR234: NGR_c31180Help
Entry
NGR_c31180        CDS       T00888                                 

Definition
(RefSeq) acyltransferase
Organism
rhi  Sinorhizobium fredii NGR234
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyltransferase
Motif
Other DBs
NCBI-GeneID: 7792389
NCBI-ProteinID: YP_002827606
RhizoBase: NGR_c31180
UniProt: C3M9S8
Position
complement(3277089..3278003)
Genome map
AA seq 304 aa AA seqDB search
MARRDSASALAHFAGAIALVSQGRPGHIVDTLIAERGQKIVRHPLWPVMRPFLHTLLNYR
KAIEFANAVANMPGFQAFEHLSALLALDIRVDKAERIPAEGGFLLVSNHPTGIADGIAVF
DLLKSRRPDMMFFANRDAIRVNPRFVEMVIPVEWREEYKSKLKARETLQVTNRAIEEGKA
TVLFPSGRIAYWAEGRLNERPWKSSAVSFARKYNLPILPVHMSARNSGLFYWFAKWSTEL
RDMTVFHELLNKKGDLFDFRVGNLIPPEALDGDPTEVTRALERHTVFALARDSDAAFDAL
RHRD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggcgagacgtgattcggcgagcgcgctggcgcattttgcaggggcaattgcgctggtc
tcgcagggccgccccggtcacatcgtcgacacgctgattgccgagcgcggccagaagatc
gtccggcatccgctctggccggtgatgcggccctttctccacacgctgctcaactaccgc
aaggcgatcgagttcgccaacgcggtcgccaacatgccgggcttccaggctttcgagcac
ttgagcgcgctgctcgcgctcgacatccgcgtcgacaaggccgagcggattccggctgag
ggcggatttctcctcgtcagcaaccacccgaccggcatcgccgacggcattgccgtcttc
gatctcctgaagagccgccggccggacatgatgttcttcgccaaccgcgacgccatccgc
gtcaacccgcgtttcgtcgagatggtcatccccgtggaatggcgcgaggaatacaagtcg
aagctcaaggcacgcgagacgttgcaggtcaccaaccgggccatcgaagaggggaaggcg
acggtactctttccgtccggccgcatcgcttactgggccgaggggcgtctcaacgaacgc
ccctggaaaagttccgccgtcagctttgcccgcaaatacaatctgccgatcctgccggtg
catatgagcgcgcgcaattccgggctgttctattggttcgccaaatggtcgacggaactg
cgcgacatgaccgtgttccacgagcttctgaacaagaagggcgaccttttcgattttcga
gtcggcaacctcattcctccagaggcgctcgacggcgacccgacggaagtgacccgggcg
ctcgaacgccataccgtcttcgcgcttgcgcgcgatagcgatgccgccttcgatgcgctg
cgccatcgggactga

DBGET integrated database retrieval system