KEGG   Sinorhizobium fredii NGR234: NGR_c31260Help
Entry
NGR_c31260        CDS       T00888                                 

Gene name
sucB2
Definition
(RefSeq) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00020  Citrate cycle (TCA cycle)
rhi00310  Lysine degradation
rhi00380  Tryptophan metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
Module
rhi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NGR_c31260 (sucB2)
  09105 Amino acid metabolism
   00310 Lysine degradation
    NGR_c31260 (sucB2)
   00380 Tryptophan metabolism
    NGR_c31260 (sucB2)
Enzymes [BR:rhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NGR_c31260 (sucB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 7792397
NCBI-ProteinID: YP_002827614
RhizoBase: NGR_c31260
UniProt: C3M9T6
Position
complement(3284509..3285750)
Genome map
AA seq 413 aa AA seqDB search
MATEIRVPTLGESVSEATVGTWFKKVGDAIKADEPLLELETDKVTIEVPAPAAGTLSEIV
AQAGETVGLGALLGQIAEGAGAAAAAPAAAEKKPEPAAAAPAAQPAAVGTPQAQSSMPPA
PAAAKLLAENNLSADQVDGSGKRGQVLKGDVLAAVAKGISAPAAAEPAKVQARAPATAED
AVREERVKMTRLRQTIARRLKDAQNTAAMLTTYNEVDMSAVMSLRNKYKDIFEKKHGVKL
GFMGFFTKAVTHALKELPAVNAEIDGSDIIYKNYCHIGVAVGTDKGLVVPIVRDADQMSI
AEIEKDIGRLGKAARDGALSMADMQGGTFTISNGGVYGSLMSSPILNAPQSGILGMHKIQ
DRPVAIGGQVVIRPMMYLALSYDHRIVDGKEAVTFLVRVKESLEDPERLVLDL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaaatccgcgttcctaccctcggcgagtccgtcagcgaagcgaccgtcggg
acctggttcaagaaggtcggcgatgcgatcaaggccgacgagccgcttctcgagctcgag
accgacaaggtgacgatcgaagtgccggcgccggccgccggtacgctcagcgaaatcgtc
gcgcaggcgggcgagaccgtcggcctcggcgcgctgctcggccagatcgccgaaggcgcc
ggtgccgccgcagccgctccggctgcggccgagaagaagcccgagcccgctgctgccgct
ccggctgcccagccggccgccgttggcacgccccaggctcagtcctcgatgccgccggcc
ccggccgccgccaagctgcttgccgaaaacaacctctcggccgaccaggtcgacggctcg
ggcaagcgcggccaggtgctgaagggtgacgtgctcgccgccgtcgccaaggggatctcg
gcgcctgcagccgccgaaccggccaaggtccaggcgcgcgccccggcgacggccgaggac
gctgtccgcgaagagcgcgtcaagatgacccgcctgcgccagacgattgcccggcgcctc
aaggacgcccagaacaccgcggcgatgctcaccacctacaacgaggtggacatgagcgcc
gtcatgagcctgcgcaacaagtacaaggacatcttcgagaagaagcacggcgtgaagctc
ggcttcatgggcttcttcaccaaggccgtcacgcacgcgctgaaggagttgccggctgtc
aacgccgagatcgacggctccgacatcatctacaagaactactgccatatcggcgtcgcc
gtcggcaccgacaagggtcttgtcgttccgatcgtgcgggacgccgaccagatgtcgatc
gccgagatcgagaaggacatcggccgtctcggcaaggcggcgcgcgacggcgcgctgtcg
atggccgacatgcagggtggcaccttcaccatctccaatggcggcgtctacggttcgctg
atgtcctcgccgatcctcaatgcgccgcagtcgggcatcctcggcatgcacaagatccag
gaccgtccggtcgcgatcggcggccaggtcgtcatccgtccgatgatgtatctggcgctc
tcctacgatcaccgcatcgtcgacggcaaggaagccgtgaccttcctggtgcgcgtcaag
gaaagcctcgaagacccggaacgtctggtgctcgacctctag

DBGET integrated database retrieval system