KEGG   Sinorhizobium fredii NGR234: NGR_c32720Help
Entry
NGR_c32720        CDS       T00888                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00071  Fatty acid degradation
rhi00072  Synthesis and degradation of ketone bodies
rhi00280  Valine, leucine and isoleucine degradation
rhi00310  Lysine degradation
rhi00362  Benzoate degradation
rhi00380  Tryptophan metabolism
rhi00620  Pyruvate metabolism
rhi00630  Glyoxylate and dicarboxylate metabolism
rhi00640  Propanoate metabolism
rhi00650  Butanoate metabolism
rhi00900  Terpenoid backbone biosynthesis
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
rhi01212  Fatty acid metabolism
rhi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rhi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NGR_c32720
   00630 Glyoxylate and dicarboxylate metabolism
    NGR_c32720
   00640 Propanoate metabolism
    NGR_c32720
   00650 Butanoate metabolism
    NGR_c32720
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NGR_c32720
   00072 Synthesis and degradation of ketone bodies
    NGR_c32720
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NGR_c32720
   00310 Lysine degradation
    NGR_c32720
   00380 Tryptophan metabolism
    NGR_c32720
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NGR_c32720
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NGR_c32720
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NGR_c32720
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rhi04147]
    NGR_c32720
Enzymes [BR:rhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NGR_c32720
Exosome [BR:rhi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NGR_c32720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt TUSC2
Motif
Other DBs
NCBI-GeneID: 7792540
NCBI-ProteinID: YP_002827756
RhizoBase: NGR_c32720
UniProt: C3MAL0
Position
complement(3432089..3433270)
Genome map
AA seq 393 aa AA seqDB search
MSNPSIVIASAARTAVGSFNGAFGNTPAHELGATVIKAVLERAGVDAAEVDEVILGQVLP
AGEGQNPARQAAIKAGVPQEKTAWGMNQLCGSGLRAVALGMQQIATGDASIIVAGGMESM
SMAPHCAHLRGGVKMGDYKMIDTMIKDGLTDAFYGYHMGTTAENVARKWQLTREEQDEFA
LRSQNKAEAAQKAGRFADEIVPFIVKTRKGDVTVDQDEYIRHGATLESIAKLRPAFDKEG
TVTAGNASGLNDGAAATLLMTEAEAAKRGIQPLARIVSWATAGVDPQIMGTGPIPASRKA
LEKAGWPIGDVELVEANEAFAAQACAVNKDLGWDPSIVNVNGGAIAIGHPIGASGARVLN
TLLFEMKRRGVSKGLATLCIGGGMGVAMCVERL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatccctccatcgtgatcgccagcgccgctcgcaccgcagtcgggtccttcaac
ggcgccttcggcaacactcccgctcatgaactgggtgcaacggtcatcaaggcggtcctc
gaacgggccggtgtcgatgcggcagaggtcgacgaggtgatcctcggccaggtgcttccg
gccggcgaagggcagaacccggcccgccaggcggcgatcaaggccggcgtcccgcaggaa
aagaccgcctggggcatgaaccagctctgcggctcgggcttgcgcgccgtcgccctcggc
atgcagcagatcgccaccggcgatgcgagcatcatcgtcgccggcggcatggagtcgatg
tcgatggcgccgcattgcgcccatctgcgcggcggcgtgaagatgggcgactacaagatg
atcgacacgatgatcaaggacggcctgaccgacgccttctacggctaccacatgggcacc
accgccgagaacgtggcgcgcaagtggcagctgacccgcgaggagcaggacgaattcgcg
ctccgctcgcagaacaaggccgaggcggcgcagaaggccggccgcttcgccgacgagatc
gtccccttcatcgtcaagacgcgcaagggcgacgtcaccgtcgatcaggacgaatatatc
cgccacggcgccacgctcgagtcgattgccaagctcaggccggccttcgacaaggaagga
acggtgaccgccggcaatgcctccgggctcaatgacggcgccgccgcgacgctgctgatg
accgaggccgaggctgccaaacgcggcatccagccgctcgcccgcatcgtctcctgggcg
acggccggcgtcgacccgcagatcatgggcaccggcccgattcccgcctcccgcaaggcg
ctcgagaaggccggctggccgatcggcgacgtcgaactcgtcgaggccaacgaagccttc
gcggcgcaggcctgcgcggtcaacaaggatctcggctgggatccgtcgatcgtcaacgtc
aacggcggcgcgatcgccatcggccatccgatcggcgcttccggtgcccgcgtcctcaac
acgctgctcttcgagatgaagcggcgcggcgtttccaagggccttgcaaccttgtgcatc
ggcggcggcatgggcgtcgccatgtgcgtcgagcgcctgtaa

DBGET integrated database retrieval system