KEGG   Sinorhizobium fredii NGR234: NGR_c33330Help
Entry
NGR_c33330        CDS       T00888                                 

Gene name
ascA
Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00010  Glycolysis / Gluconeogenesis
rhi00620  Pyruvate metabolism
rhi00640  Propanoate metabolism
rhi00680  Methane metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01130  Biosynthesis of antibiotics
rhi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NGR_c33330 (ascA)
   00620 Pyruvate metabolism
    NGR_c33330 (ascA)
   00640 Propanoate metabolism
    NGR_c33330 (ascA)
  Energy metabolism
   00680 Methane metabolism
    NGR_c33330 (ascA)
Enzymes [BR:rhi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NGR_c33330 (ascA)
Lipid biosynthesis proteins [BR:rhi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NGR_c33330 (ascA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 7792600
NCBI-ProteinID: YP_002827816
RhizoBase: NGR_c33330
UniProt: C3MAS0
Position
complement(3517815..3519764)
Genome map
AA seq 649 aa AA seqDB search
MDVKTYPVLEAAKNRTLVDNATYLKWYEESVADPEKFWGEHGKRIEWFEPYTTVKNTSFD
GNVSIKWFEDGLTNVSYNCIDRHLKTHGEKTAIIWEGDNPYIDKRITYNELYDKVCRLAN
VLKKHGVEKGDRVTIYMPMVPEAAYAMLACARIGAIHSVVFGGFSPEALAGRIVDCESTF
VITCDEGLRGGKPVPLKENTEKAIDIAARQHVMVNKVLVVRRTGGKVPWAPGRDVWYHQE
IATVEPHCPPEKMRAEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTHQYVFDYHDGDI
YWCTADVGWVTGHSYIVYGPLANAATTLMFEGVPNFPDAGRFWEVIDKHKVNIFYTAPTA
IRSLMGAGDDFVNRSSRSSLRLLGTVGEPINPEAWEWYYHVVGAERSPIVDTWWQTETGG
ILITPLPGATDLKPGSATRPFFGVKPQIVDNEGNVIDGPADGNLCITDSWPGQMRTVYGD
HERFIQTYFSTYKGKYFTGDGCRRDEDGYYWITGRVDDVLNVSGHRLGTAEVESALVSHH
LVSEAAVVGYPHPIKGQGIYCYVSLMAGEVGSDELRQELVKHVRSEIGPIATPDKIQFAP
GLPKTRSGKIMRRILRKIAEDDFGSLGDTSTLADPAVVDDLIANRQNRG
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcaagacctatccggtcctggaagcggccaagaaccgcacgcttgtcgacaac
gcgacctatctgaaatggtatgaggaaagcgttgccgatccggagaagttctggggtgag
cacggcaagcggatcgaatggttcgagccctataccacggtcaagaatacgtccttcgac
ggcaatgtttcgatcaagtggttcgaagacgggctgaccaacgtctcctacaattgcatc
gatcgccatttgaagacccatggcgagaagaccgcaatcatctgggagggcgacaatccc
tacatcgacaagaggatcacctataacgagctctacgacaaggtttgccggcttgccaac
gtgctcaagaagcatggcgtcgagaaaggcgaccgcgtcaccatctacatgccgatggtg
ccggaagcggcctatgcgatgctcgcctgcgcccgcatcggcgcgatccactcggtggtt
ttcggtggcttctcgccggaggcgctcgccggccgcatcgtcgactgcgaatccaccttc
gtgatcacctgcgacgagggcttgcgcggcggcaagccggtgccgctcaaggaaaacacc
gaaaaggcgatcgacatcgctgcccggcagcatgtcatggtcaacaaggtgctggtcgtc
cgccgcaccggcggcaaggtgccgtgggcgccgggccgcgacgtctggtatcatcaggaa
atcgccacggtcgagccgcattgcccgccggaaaagatgcgcgccgaggacccgctgttc
attctctatacgtccggatcgaccggcaagccgaagggcgtgctgcacacgaccggcggc
tatctcgtctacgcctcgatgacacatcaatatgtcttcgactatcacgacggcgatatc
tactggtgcacggccgatgtcggctgggtcaccggccactcctatatcgtctacgggccg
ctcgccaacgccgcgacgacgctgatgttcgagggcgtgccgaatttcccggatgccggc
cgcttctgggaagtgatcgacaagcacaaggtcaatatcttctacaccgccccgaccgcc
atccgctcgctgatgggcgccggcgacgatttcgtcaatcgctcgtcgcgctcgtcgctg
cgtctgctcggcactgtcggcgaaccgatcaatccggaagcctgggagtggtactaccat
gtcgtcggcgcggagcgctcgccgatcgtcgacacgtggtggcagacggagaccggcggc
atcctgatcacgccgctgccgggcgcgaccgatctcaagcctggttcggcgacgcggccg
ttcttcggcgtcaagccgcagatcgtcgacaatgaaggaaacgtgatcgacgggccggcc
gacggcaatctctgcatcaccgacagctggccggggcagatgcgcaccgtctatggcgac
cacgagcgcttcatccagacctatttctccacctacaagggcaagtacttcaccggcgac
ggctgccgccgcgacgaggacggctactactggatcaccggccgcgtcgacgacgtgttg
aatgtatcgggtcaccgcctcggcacggcggaagtcgaatcggcgctcgtttcgcaccat
ctcgtctcggaagcggcggtggtcggctacccgcacccgatcaagggccagggtatctat
tgctacgtgtcgctgatggccggcgaggtcggcagcgacgagctgcgccaggaactcgtc
aagcatgtgcgttcggagatcgggccgatcgccacgccggacaagatccagttcgcgccc
ggcctgccgaagacccgctccggcaagatcatgcggcggattctgcgcaagatcgccgag
gacgacttcggttcgctcggcgacacctcgacgctcgccgatccggcggtcgtcgacgac
ctgatcgccaatcgccagaaccgcgggtga

DBGET integrated database retrieval system