KEGG   Sinorhizobium fredii NGR234: NGR_c34110Help
Entry
NGR_c34110        CDS       T00888                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
rhi00620  Pyruvate metabolism
rhi00630  Glyoxylate and dicarboxylate metabolism
rhi01100  Metabolic pathways
rhi01110  Biosynthesis of secondary metabolites
rhi01120  Microbial metabolism in diverse environments
rhi01200  Carbon metabolism
Module
rhi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NGR_c34110 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    NGR_c34110 (glcB)
Enzymes [BR:rhi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NGR_c34110 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-GeneID: 7792678
NCBI-ProteinID: YP_002827894
RhizoBase: NGR_c34110
UniProt: C3MBD2
Position
3607326..3609500
Genome map
AA seq 724 aa AA seqDB search
MDRVEKHDLKIDAGLHRFLVDEAMPGTGIDPEHFFAALSALVHDLAPKNRALLARRDELQ
AKLDAWYREHGAPVDLDAYQAFLKEIGYLLPEGPDFSVSTANVDAEIATIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPDADGGTRGRSYNPARGAKVIAWARDFLDASVPL
AAGRWSDVGGLAIDGTALSLTLTNGTKTTLRNPAQFAGYSGSAEAPSQIVLRQNNLHVVI
VLDATTPIGQADPAGISDIILESAITTIMDCEDSVAAVDAEDKVVVYRNWLGLMKGDLAE
EVAKGGRTFTRKLNADRVFTRPNGETLTLPGRALMLVRNVGHLMTNPAILDRDGREVPEG
LMDAMVTALIALHDIGANGRRANSRAGSMYVVKPKMHGPEEVAFACEIFSHVEAALGLPE
NTIKMGIMDEERRTTVNLKECIRAARDRVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMK
QAAWIGAYENWNVDIGLECGLSGRAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPS
PTAATLHATHYHRVDVAEVQAGLGSRPRARLADILSVPVAARPNWTEEEIQRELDNNAQG
ILGYVVRWVDEGVGCSKVPDINNVGLMEDRATLRISAQHMANWLHHGIVSKVQIVETMKR
MAEIVDRQNAGDPSYVPMAGRLEQSIAFQAALDLVLKGREQPNGYTEPVLHRRRLELKAK
QRAS
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcgttgagaaacatgatctgaagatcgatgcgggccttcaccgcttcctggtc
gatgaggcgatgccgggcaccgggatcgatccggagcatttctttgccgctctgtcggcg
ctcgttcacgatctcgcgccgaagaaccgcgcccttctcgccaggcgcgacgagctccag
gcgaagctcgacgcctggtatcgcgagcatggcgccccggtcgacctcgacgcctaccag
gccttcctgaaggagatcggctatctcctgccggaaggaccggacttttccgtgtcgacc
gccaatgtcgatgccgagattgccaccattgccggcccgcagctggtcgtgccggtgatg
aatgcccgctatgcgctgaacgccgcaaatgcgcgctggggctcgctctatgacgcgctc
tacggcaccgatgccattcccgatgcggatggggggacgcgcggcagaagctacaatccg
gcgcgaggtgcgaaggtcatagcctgggcacgggattttctcgacgcaagcgttccgctt
gccgcaggccgctggagcgatgtcggcgggctggcgatcgacgggactgctctctcgttg
acactgacgaacggcaccaagacgacgcttcgcaatccggcccagttcgccggctattcc
ggctcggccgaggcgccttcgcaaatcgtcctccgccagaacaaccttcacgtcgtgatc
gtcctcgatgcgacgacgccgatcggccaggccgacccggccggtatttccgacatcatc
ctcgaatcggcgatcaccacgatcatggactgcgaggattccgttgccgcggtcgatgcc
gaggacaaggtcgtcgtctatcgcaactggctggggctgatgaagggcgatctcgcggaa
gaggtcgccaagggcggccgaacgttcacgagaaagctgaatgccgaccgcgtcttcacc
agaccaaatggcgaaacgctgaccctgcccggccgcgcgctgatgctggtgcgcaatgtc
ggccacctgatgaccaatccggcgatcctcgaccgcgacggccgcgaggttccggaaggc
ctgatggatgccatggtgacggcgctgatcgccctgcacgacatcggcgcgaacggccgc
cgggcaaactcgcgcgccggttcgatgtatgtggtcaagccgaagatgcatggtcccgag
gaagttgccttcgcctgcgagattttttcgcacgtcgaggcggcgctcgggctgccggaa
aacaccatcaagatgggcatcatggacgaggagcggcgcacgaccgtcaacctcaaggaa
tgcatccgcgccgcccgcgaccgcgtcgtcttcatcaataccggtttcctcgaccgcacc
ggcgacgaaatccacacctcgatggaagccggcccgatgatccgcaagggcgacatgaag
caggcggcctggatcggtgcctacgagaactggaatgtcgacatcggcctcgaatgcggg
ctttccggccgagcccagatcggcaagggcatgtgggcgatgcccgacctgatggccgcg
atgctggagcagaagatcgcccatccgaaagccggcgccaacaccgcctgggttccctcg
ccaacggccgcgacgctgcatgcgacgcactatcaccgggtcgacgtcgccgaagtgcag
gcgggcctcgggagccggccgcgcgccaggctcgccgatattctctcggtgcccgtggcg
gcgcggccgaactggacggaagaggagatccaacgcgaactcgacaacaacgcgcaaggg
attctcggctatgtcgtgcgctgggtcgacgagggcgtcggctgctccaaggttccggac
atcaacaatgtcgggctgatggaagaccgcgcgacgctgcgcatctccgcgcagcacatg
gccaactggctgcaccacggcatagtcagcaaggtgcagatcgtcgagacgatgaagcgg
atggcggaaatcgtcgaccggcagaatgccggcgatccgagttacgtgccaatggccgga
cgtctcgaacaatcgatcgccttccaggcggcgctcgatctggtcctcaagggccgcgag
cagccgaacggctataccgaaccggtgctgcaccgccgccggttggagttgaaggcgaag
caacgggcgtcgtga

DBGET integrated database retrieval system